ZFYVE27 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-83512

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (95%), Rat (97%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: RLRKRYPTNNFGNCTGCSATFSVLKKRRSCSNCGNSFCSRCCSFKVPKSSMGATAPEAQRETVFVCASCNQTLSK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ZFYVE27 Antibody - BSA Free

Immunohistochemistry-Paraffin: ZFYVE27 Antibody [NBP1-83512]

Immunohistochemistry-Paraffin: ZFYVE27 Antibody [NBP1-83512]

Immunohistochemistry-Paraffin: ZFYVE27 Antibody [NBP1-83512] - Staining of human kidney shows strong cytoplasmic granular positivity in cells in tubules.
Immunohistochemistry-Paraffin: ZFYVE27 Antibody [NBP1-83512]

Immunohistochemistry-Paraffin: ZFYVE27 Antibody [NBP1-83512]

Immunohistochemistry-Paraffin: ZFYVE27 Antibody [NBP1-83512] - Staining of human colon shows strong cytoplasmic granular positivity in glandular cells.
Immunohistochemistry-Paraffin: ZFYVE27 Antibody [NBP1-83512]

Immunohistochemistry-Paraffin: ZFYVE27 Antibody [NBP1-83512]

Immunohistochemistry-Paraffin: ZFYVE27 Antibody [NBP1-83512] - Staining of human fallopian tube shows strong cytoplasmic granular positivity in glandular cells.
Immunohistochemistry-Paraffin: ZFYVE27 Antibody [NBP1-83512]

Immunohistochemistry-Paraffin: ZFYVE27 Antibody [NBP1-83512]

Immunohistochemistry-Paraffin: ZFYVE27 Antibody [NBP1-83512] - Staining of human pancreas shows moderate cytoplasmic granular positivity in exocrine glandular cells.
ZFYVE27 Antibody - BSA Free Western Blot: ZFYVE27 Antibody - BSA Free [NBP1-83512]

Western Blot: ZFYVE27 Antibody - BSA Free [NBP1-83512]

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue

Applications for ZFYVE27 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ZFYVE27

ZFYVE27 is a gene that codes for a protein with eight isoforms, with lengths of 411, 404, 416, 285, 318, 286, 311, and 372 amino acids and weights of approximately 46, 45, 46, 31, 35, 32, 35, and 41 kDa respectively. ZFYVE27 is an upstream inhibitor of RAB11, which regulates directional protein transport to the forming neurites, meaning it is involved in nerve growth factor-induced neurite formation. Current research is being done on several diseases and disorders related to this gene including paraplegia, spasticity, cholangiocarcinoma, and Alzheimer's disease. ZFYVE27 has also been shown to have interactions with VAPA, VAPB, FKBP8, RAB11A, and CCT3.

Alternate Names

FLJ32919, PROTRUDIN, RP11-459F3.2, SPG33, zinc finger FYVE domain-containing protein 27, zinc finger, FYVE domain containing 27

Gene Symbol

ZFYVE27

Additional ZFYVE27 Products

Product Documents for ZFYVE27 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ZFYVE27 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ZFYVE27 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ZFYVE27 Antibody - BSA Free and earn rewards!

Have you used ZFYVE27 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...