ZNF135 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-80913
Loading...
Key Product Details
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FLWDGLWYCRGEDTEGHWEWSCESLESLAVPVAFTPVKTPVLEQWQRNGFGENISLNPDLPHQPMTPERQSPHTWGTRGKREKPDLNVLQKTCVKEKPYKCQECGKAFSHSSALI
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for ZNF135 Antibody - BSA Free
Western Blot: ZNF135 Antibody [NBP1-80913]
Western Blot: ZNF135 Antibody [NBP1-80913] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: ZNF135 Antibody [NBP1-80913]
Immunocytochemistry/Immunofluorescence: ZNF135 Antibody [NBP1-80913] - Staining of human cell line HEK 293 shows localization to cytosol. Antibody staining is shown in green.Immunohistochemistry-Paraffin: ZNF135 Antibody [NBP1-80913]
Immunohistochemistry-Paraffin: ZNF135 Antibody [NBP1-80913] - Staining of human ovary shows moderate nuclear positivity in follicle cells and ovarian stroma cells.Western Blot: ZNF135 Antibody - BSA Free [NBP1-80913] -
PI3K/AKT and JNK mediate the effect of HNRNPA3 on SREBF1 activation. (A) Marc-145 cells were transfected with siNC or increasing amounts of siHNRNPA3 and infected with PEDV (MOI = 0.5) for 24 h. The protein levels of SREBF1, FASN, and ACC1 were determined by western blot. beta -Actin was used as a loading control. (B) Marc-145 cells were transfected with siHNRNPA3 and infected with PEDV (MOI = 0.5), then incubated with LY294002 (LY294, 10 uM), SP600125 (SP600, 10 uM), trametinib (Tram, 10 uM), or DMSO (1:1,000). The mRNA levels of SREBF1 were determined by qPCR. (C–E) Marc-145 cells were transfected with siHNRNPA3 and infected with PEDV (MOI = 0.5), then incubated with LY294002/SP600125/trametinib or DMSO. The protein levels of SREBF1 were determined by western blot. beta -Actin was used as a loading control. (F) Marc-145 cells were transfected and treated as described above. The cells were harvested for dual-luciferase assays. (G and H) Marc-145 cells were transfected and treated as described above. The mRNA levels of FASN and ACC1 were determined by qPCR, and the supernatant was harvested to assess the virus titer by TCID50. (I and J) Marc-145 cells were transfected and treated as described above. The mRNA and protein levels of ZNF135 were determined by qPCR and western blot. beta -actin was used as a loading control. Three independent experiments were carried out. Error bars represent the mean +/- SD for triplicate experiments. *P < 0.05, **P < 0.01. ns, not significant. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38259103), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for ZNF135 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: ZNF135
Alternate Names
pT3, zinc finger protein 135, zinc finger protein 61, zinc finger protein 78-like 1 (pT3), ZNF61, ZNF78L1
Entrez Gene IDs
7694 (Human)
Gene Symbol
ZNF135
Additional ZNF135 Products
Product Documents for ZNF135 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for ZNF135 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for ZNF135 Antibody - BSA Free
Customer Reviews for ZNF135 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review ZNF135 Antibody - BSA Free and earn rewards!
Have you used ZNF135 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...