ZNF148 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-94521

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 690-794 of human ZNF148 (NP_068799.2). SGDETNHASATSTQDFLDQVTSQKKAEAQPVHQAYQMSSFEQPFRAPYHGSRAGIATQFSTANGQVNLRGPGTSAEFSEFPLVNVNDNRAGMTSSPDATTGQTFG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

89 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ZNF148 Antibody - BSA Free

Western Blot: ZNF148 AntibodyBSA Free [NBP2-94521]

Western Blot: ZNF148 AntibodyBSA Free [NBP2-94521]

Western Blot: ZNF148 Antibody [NBP2-94521] - Analysis of extracts of various cell lines, using ZNF148 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.
Immunocytochemistry/ Immunofluorescence: ZNF148 Antibody - BSA Free [NBP2-94521]

Immunocytochemistry/ Immunofluorescence: ZNF148 Antibody - BSA Free [NBP2-94521]

Immunocytochemistry/Immunofluorescence: ZNF148 Antibody [NBP2-94521] - Immunofluorescence analysis of A-549 cells using ZNF148 antibody (NBP2-94521).
Immunohistochemistry-Paraffin: ZNF148 Antibody - BSA Free [NBP2-94521]

Immunohistochemistry-Paraffin: ZNF148 Antibody - BSA Free [NBP2-94521]

Immunohistochemistry-Paraffin: ZNF148 Antibody [NBP2-94521] - Paraffin-embedded mouse brain using ZNF148.
ZNF148 Antibody - BSA Free

Immunohistochemistry: ZNF148 Antibody - BSA Free [ZNF148] -

Immunohistochemistry: ZNF148 Antibody - BSA Free [ZNF148] - Immunohistochemistry analysis of paraffin-embedded Rat brain using ZNF148 Rabbit pAb at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ZNF148 Antibody - BSA Free

Immunohistochemistry: ZNF148 Antibody - BSA Free [ZNF148] -

Immunohistochemistry: ZNF148 Antibody - BSA Free [ZNF148] - Immunohistochemistry analysis of paraffin-embedded Human colon using ZNF148 Rabbit pAb at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Applications for ZNF148 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:20 - 1:100

Immunohistochemistry

1:50-1:100

Western Blot

1:500-1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ZNF148

ZBP-89, also known as BFCOL1, BERF1 and ZNF 148, is a zinc finger transcription factor that is universally expressed. ZBP-89, a Kruppel-like repressor protein, is the silencer element binding factor for Vimentin. ZBP-89 has been shown to bind to GC-rich DNA elements in promoters for gastrin, ornithine decarboxylase and the cyclin-dependent kinase inhibitor p21 (also designated Cip1 or WAF1). ZBP-89 expression is induced by trans-retinoic acid or butyrate, which also induces terminal differentiation of colon cancer cells. ZBP-89 cooperates with histone acetyltransferase coactivator p300 in the regulation of p21, a cyclin-dependent kinase inhibitor whose associated gene is a target gene of p53. ZBP-89 also regulates cell proliferation, in part, through its ability to directly bind the p53 protein and retard its nuclear export. Elevated levels of ZBP-89 induce growth arrest and apoptosis in human gastrointestinal cells.

Alternate Names

BERF-1, BFCOL1, CACCC box-binding protein, CLL-associated antigen KW-10, HT-BETA, pHZ-52, Transcription factor ZBP-89, ZBP89, ZBP-89, ZFP148zinc finger protein 148 (pHZ-52), Zinc finger DNA-binding protein 89, zinc finger protein 148

Gene Symbol

ZNF148

Additional ZNF148 Products

Product Documents for ZNF148 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ZNF148 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ZNF148 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ZNF148 Antibody - BSA Free and earn rewards!

Have you used ZNF148 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...