ZNF354C Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-81352
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LVSLGIPFSMPKLIHQLQQGEDPCMVEREVPSDTRLGFKTWLETEALPHRQDIFIEETSQGMVKKESIKDGHWDINFEEAVEFE
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for ZNF354C Antibody - BSA Free
Western Blot: ZNF354C Antibody [NBP1-81352]
Western Blot: ZNF354C Antibody [NBP1-81352] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG spImmunocytochemistry/ Immunofluorescence: ZNF354C Antibody [NBP1-81352]
Immunocytochemistry/Immunofluorescence: ZNF354C Antibody [NBP1-81352] - Staining of human cell line SH-SY5Y shows localization to nuclear membrane & cytosol. Antibody staining is shown in green.Immunohistochemistry-Paraffin: ZNF354C Antibody [NBP1-81352]
Immunohistochemistry-Paraffin: ZNF354C Antibody [NBP1-81352] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.Immunohistochemistry-Paraffin: ZNF354C Antibody [NBP1-81352]
Immunohistochemistry-Paraffin: ZNF354C Antibody [NBP1-81352] - Staining of human endometrium shows strong cytoplasmic positivity in glandular cells.Immunohistochemistry-Paraffin: ZNF354C Antibody [NBP1-81352]
Immunohistochemistry-Paraffin: ZNF354C Antibody [NBP1-81352] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.Immunohistochemistry-Paraffin: ZNF354C Antibody [NBP1-81352]
Immunohistochemistry-Paraffin: ZNF354C Antibody [NBP1-81352] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.Chromatin Immunoprecipitation-exo-Seq: ZNF354C Antibody - BSA Free [NBP1-81352]
ChIP-Exo-Seq composite graph for Anti-ZNF354C (NBP1-81352) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.Western Blot: ZNF354C Antibody - BSA Free [NBP1-81352] -
The conserved amino acid sequence MLE within the KRAB domain of ZNF354C mediates transcriptional repression. (a) Schematic of the ZNF354C protein architecture with its KRAB domain and 11 C2H2 Zinc fingers. Amino acids within the KRAB domain as targets for site-directed mutagenesis are indicated. Numbers below the protein indicate the amino acid position. (b) Alignment of KRAB sequences of various ZNF proteins with ZNF354C as a reference. The numbers within the protein names indicate the amino acid positions within the respective protein. The underlined (blue) and red amino acids were subjected to site-directed mutagenesis. (c) Alignment of the human ZNF354C KRAB sequence with other mammalian ZNF354C homologues. The numbers within the protein names indicate the amino acid positions within the respective protein. The underlined (blue) and red amino acids were subjected to site-directed mutagenesis. (d, e) RT-qPCR (d) and western blot (e) of ZNF354C after overexpression of pCMV6-ZNF354C (354C) or the individual mutants DV (DV → AA), MLE (MLE → KKK) or EW (EW → AA). pCMV6-Entry served as negative control (CTL). Data in d is normalised to b-actin. n = 9. Data are mean +/- SEM. Paired t-test; *P < 0.05. In e, antibodies against ZNF354C and HSC70/HSP70 are shown. (f) RT-qPCR of RGS5, PATL2, HAP1, NRAV and HERC5 after overexpression of pCMV6-ZNF354C (WT, dotted line, set as 1) or the individual mutants DV (DV → AA), MLE (MLE → KKK) or EW (EW → AA). Data is normalised to b-actin. n = 3. Data are mean +/- SEM. Paired t-test; *P < 0.05. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/33154469), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: ZNF354C Antibody - BSA Free [NBP1-81352] -
Zinc Finger Protein 354C (ZNF354C) overexpression leads to inhibition of sprouting in HMEC-1. (a) RNA expression level as measured with RT-qPCR of ZNF354C in different cell types. Data is normalised to HUVEC batch 1 (set as 1) and to b-actin. n = 3. Data are mean +/- SEM. (b) Representative western blot of HUVEC, HMEC-1 and HAoSMC. ZNF354C antibody was used. HSC70/HSP70 antibodies served as loading control. (c) Immunofluorescence with an antibody against ZNF354C in HMEC-1, HUVEC and HAoSMC. Nuclei were stained with DAPI. Scale bar indicates 20 um. (d) RT-qPCR of ZNF354C after overexpression (OE) of pCMV6-ZNF354C (354C) in HMEC-1, HUVEC and HAoSMC. PCMV6-entry was used as negative control (CTL). Data is normalized to b-actin. n = 5. Data are mean +/- SEM. Mann–Whitney t-test; *P < 0.05. (e) Representative western blot of untreated (native) HMEC-1, HUVEC and HAoSMC or after overexpression of pCMV6-ZNF354C (ZNF354C) or pCMV6-entry (CTL). ZNF354C, Flag or b-actin antibodies were used. (f) Immunofluorescence with an antibody against ZNF354C in HMEC-1 after overexpression of pCMV6-ZNF354C or pCMV6-entry. Nuclei were stained with DAPI. Scale bar indicates 20 um. (g, h) Spheroid outgrowth assay quantification of sprout number (g) and cumulative sprout length (h) after overexpression of pCMV6-ZNF354C (354C) or pCMV6-entry (NC). Cells were studied under basal conditions or after treatment with VEGF-A or TNF-alpha. Scale bar indicates 50 um. n = 13. One-Way ANOVA with Bonferroni post-hoc test. *P < 0.05. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/33154469), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunocytochemistry/ Immunofluorescence: ZNF354C Antibody - BSA Free [NBP1-81352] -
Zinc Finger Protein 354C (ZNF354C) overexpression leads to inhibition of sprouting in HMEC-1. (a) RNA expression level as measured with RT-qPCR of ZNF354C in different cell types. Data is normalised to HUVEC batch 1 (set as 1) and to b-actin. n = 3. Data are mean +/- SEM. (b) Representative western blot of HUVEC, HMEC-1 and HAoSMC. ZNF354C antibody was used. HSC70/HSP70 antibodies served as loading control. (c) Immunofluorescence with an antibody against ZNF354C in HMEC-1, HUVEC and HAoSMC. Nuclei were stained with DAPI. Scale bar indicates 20 um. (d) RT-qPCR of ZNF354C after overexpression (OE) of pCMV6-ZNF354C (354C) in HMEC-1, HUVEC and HAoSMC. PCMV6-entry was used as negative control (CTL). Data is normalized to b-actin. n = 5. Data are mean +/- SEM. Mann–Whitney t-test; *P < 0.05. (e) Representative western blot of untreated (native) HMEC-1, HUVEC and HAoSMC or after overexpression of pCMV6-ZNF354C (ZNF354C) or pCMV6-entry (CTL). ZNF354C, Flag or b-actin antibodies were used. (f) Immunofluorescence with an antibody against ZNF354C in HMEC-1 after overexpression of pCMV6-ZNF354C or pCMV6-entry. Nuclei were stained with DAPI. Scale bar indicates 20 um. (g, h) Spheroid outgrowth assay quantification of sprout number (g) and cumulative sprout length (h) after overexpression of pCMV6-ZNF354C (354C) or pCMV6-entry (NC). Cells were studied under basal conditions or after treatment with VEGF-A or TNF-alpha. Scale bar indicates 50 um. n = 13. One-Way ANOVA with Bonferroni post-hoc test. *P < 0.05. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/33154469), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for ZNF354C Antibody - BSA Free
Application
Recommended Usage
Chromatin Immunoprecipitation-exo-Seq
1-10ug per reaction
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:500 - 1:1000
Immunohistochemistry-Paraffin
1:500 - 1:1000
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: ZNF354C
Alternate Names
FLJ10390, ZFEND, zinc finger protein 358
Gene Symbol
ZNF354C
Additional ZNF354C Products
Product Documents for ZNF354C Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for ZNF354C Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for ZNF354C Antibody - BSA Free
Customer Reviews for ZNF354C Antibody - BSA Free
There are currently no reviews for this product. Be the first to review ZNF354C Antibody - BSA Free and earn rewards!
Have you used ZNF354C Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...