ZNF354C Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-81352

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LVSLGIPFSMPKLIHQLQQGEDPCMVEREVPSDTRLGFKTWLETEALPHRQDIFIEETSQGMVKKESIKDGHWDINFEEAVEFE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ZNF354C Antibody - BSA Free

Western Blot: ZNF354C Antibody [NBP1-81352]

Western Blot: ZNF354C Antibody [NBP1-81352]

Western Blot: ZNF354C Antibody [NBP1-81352] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: ZNF354C Antibody [NBP1-81352]

Immunocytochemistry/ Immunofluorescence: ZNF354C Antibody [NBP1-81352]

Immunocytochemistry/Immunofluorescence: ZNF354C Antibody [NBP1-81352] - Staining of human cell line SH-SY5Y shows localization to nuclear membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ZNF354C Antibody [NBP1-81352]

Immunohistochemistry-Paraffin: ZNF354C Antibody [NBP1-81352]

Immunohistochemistry-Paraffin: ZNF354C Antibody [NBP1-81352] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ZNF354C Antibody [NBP1-81352]

Immunohistochemistry-Paraffin: ZNF354C Antibody [NBP1-81352]

Immunohistochemistry-Paraffin: ZNF354C Antibody [NBP1-81352] - Staining of human endometrium shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ZNF354C Antibody [NBP1-81352]

Immunohistochemistry-Paraffin: ZNF354C Antibody [NBP1-81352]

Immunohistochemistry-Paraffin: ZNF354C Antibody [NBP1-81352] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ZNF354C Antibody [NBP1-81352]

Immunohistochemistry-Paraffin: ZNF354C Antibody [NBP1-81352]

Immunohistochemistry-Paraffin: ZNF354C Antibody [NBP1-81352] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
ZNF354C Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: ZNF354C Antibody - BSA Free [NBP1-81352]

Chromatin Immunoprecipitation-exo-Seq: ZNF354C Antibody - BSA Free [NBP1-81352]

ChIP-Exo-Seq composite graph for Anti-ZNF354C (NBP1-81352) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.
ZNF354C Antibody - BSA Free

Western Blot: ZNF354C Antibody - BSA Free [NBP1-81352] -

The conserved amino acid sequence MLE within the KRAB domain of ZNF354C mediates transcriptional repression. (a) Schematic of the ZNF354C protein architecture with its KRAB domain and 11 C2H2 Zinc fingers. Amino acids within the KRAB domain as targets for site-directed mutagenesis are indicated. Numbers below the protein indicate the amino acid position. (b) Alignment of KRAB sequences of various ZNF proteins with ZNF354C as a reference. The numbers within the protein names indicate the amino acid positions within the respective protein. The underlined (blue) and red amino acids were subjected to site-directed mutagenesis. (c) Alignment of the human ZNF354C KRAB sequence with other mammalian ZNF354C homologues. The numbers within the protein names indicate the amino acid positions within the respective protein. The underlined (blue) and red amino acids were subjected to site-directed mutagenesis. (d, e) RT-qPCR (d) and western blot (e) of ZNF354C after overexpression of pCMV6-ZNF354C (354C) or the individual mutants DV (DV → AA), MLE (MLE → KKK) or EW (EW → AA). pCMV6-Entry served as negative control (CTL). Data in d is normalised to b-actin. n = 9. Data are mean +/- SEM. Paired t-test; *P < 0.05. In e, antibodies against ZNF354C and HSC70/HSP70 are shown. (f) RT-qPCR of RGS5, PATL2, HAP1, NRAV and HERC5 after overexpression of pCMV6-ZNF354C (WT, dotted line, set as 1) or the individual mutants DV (DV → AA), MLE (MLE → KKK) or EW (EW → AA). Data is normalised to b-actin. n = 3. Data are mean +/- SEM. Paired t-test; *P < 0.05. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/33154469), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
ZNF354C Antibody - BSA Free

Western Blot: ZNF354C Antibody - BSA Free [NBP1-81352] -

Zinc Finger Protein 354C (ZNF354C) overexpression leads to inhibition of sprouting in HMEC-1. (a) RNA expression level as measured with RT-qPCR of ZNF354C in different cell types. Data is normalised to HUVEC batch 1 (set as 1) and to b-actin. n = 3. Data are mean +/- SEM. (b) Representative western blot of HUVEC, HMEC-1 and HAoSMC. ZNF354C antibody was used. HSC70/HSP70 antibodies served as loading control. (c) Immunofluorescence with an antibody against ZNF354C in HMEC-1, HUVEC and HAoSMC. Nuclei were stained with DAPI. Scale bar indicates 20 um. (d) RT-qPCR of ZNF354C after overexpression (OE) of pCMV6-ZNF354C (354C) in HMEC-1, HUVEC and HAoSMC. PCMV6-entry was used as negative control (CTL). Data is normalized to b-actin. n = 5. Data are mean +/- SEM. Mann–Whitney t-test; *P < 0.05. (e) Representative western blot of untreated (native) HMEC-1, HUVEC and HAoSMC or after overexpression of pCMV6-ZNF354C (ZNF354C) or pCMV6-entry (CTL). ZNF354C, Flag or b-actin antibodies were used. (f) Immunofluorescence with an antibody against ZNF354C in HMEC-1 after overexpression of pCMV6-ZNF354C or pCMV6-entry. Nuclei were stained with DAPI. Scale bar indicates 20 um. (g, h) Spheroid outgrowth assay quantification of sprout number (g) and cumulative sprout length (h) after overexpression of pCMV6-ZNF354C (354C) or pCMV6-entry (NC). Cells were studied under basal conditions or after treatment with VEGF-A or TNF-alpha. Scale bar indicates 50 um. n = 13. One-Way ANOVA with Bonferroni post-hoc test. *P < 0.05. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/33154469), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
ZNF354C Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ZNF354C Antibody - BSA Free [NBP1-81352] -

Zinc Finger Protein 354C (ZNF354C) overexpression leads to inhibition of sprouting in HMEC-1. (a) RNA expression level as measured with RT-qPCR of ZNF354C in different cell types. Data is normalised to HUVEC batch 1 (set as 1) and to b-actin. n = 3. Data are mean +/- SEM. (b) Representative western blot of HUVEC, HMEC-1 and HAoSMC. ZNF354C antibody was used. HSC70/HSP70 antibodies served as loading control. (c) Immunofluorescence with an antibody against ZNF354C in HMEC-1, HUVEC and HAoSMC. Nuclei were stained with DAPI. Scale bar indicates 20 um. (d) RT-qPCR of ZNF354C after overexpression (OE) of pCMV6-ZNF354C (354C) in HMEC-1, HUVEC and HAoSMC. PCMV6-entry was used as negative control (CTL). Data is normalized to b-actin. n = 5. Data are mean +/- SEM. Mann–Whitney t-test; *P < 0.05. (e) Representative western blot of untreated (native) HMEC-1, HUVEC and HAoSMC or after overexpression of pCMV6-ZNF354C (ZNF354C) or pCMV6-entry (CTL). ZNF354C, Flag or b-actin antibodies were used. (f) Immunofluorescence with an antibody against ZNF354C in HMEC-1 after overexpression of pCMV6-ZNF354C or pCMV6-entry. Nuclei were stained with DAPI. Scale bar indicates 20 um. (g, h) Spheroid outgrowth assay quantification of sprout number (g) and cumulative sprout length (h) after overexpression of pCMV6-ZNF354C (354C) or pCMV6-entry (NC). Cells were studied under basal conditions or after treatment with VEGF-A or TNF-alpha. Scale bar indicates 50 um. n = 13. One-Way ANOVA with Bonferroni post-hoc test. *P < 0.05. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/33154469), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for ZNF354C Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ZNF354C

ZNF354C may function as a transcription repressor. Suppresses osteogenic effects of RUNX2. Binds to 5'-CCACA-3' core sequence. May be involved in osteoblastic differentiation

Alternate Names

FLJ10390, ZFEND, zinc finger protein 358

Gene Symbol

ZNF354C

Additional ZNF354C Products

Product Documents for ZNF354C Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ZNF354C Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for ZNF354C Antibody - BSA Free

Customer Reviews for ZNF354C Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ZNF354C Antibody - BSA Free and earn rewards!

Have you used ZNF354C Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...