ZNF498 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33818

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ZNF498 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: PAVNPRDQEMAAGFFTAGSQGLGPFKDMALAFPEEEWRHVTPAQIDCFGEYVEPQDCRVSPGGGSKE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ZNF498 Antibody - BSA Free

Immunohistochemistry: ZNF498 Antibody [NBP2-33818]

Immunohistochemistry: ZNF498 Antibody [NBP2-33818]

Immunohistochemistry: ZNF498 Antibody [NBP2-33818] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.
ZNF498 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: ZNF498 Antibody - BSA Free [NBP2-33818]

Chromatin Immunoprecipitation-exo-Seq: ZNF498 Antibody - BSA Free [NBP2-33818]

ChIP-Exo-Seq composite graph for Anti-ZSCAN25 (NBP2-33818) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for ZNF498 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ZNF498

The ZNF498 gene encodes a protein that bears some similarity to zinc finger proteins, which are involved in DNA binding and protein-protein interactions. Multiple alternatively spliced transcript variants have been identified, but the full-length nature for mos

Alternate Names

C2H2-171, RP58Zinc finger and BTB domain-containing protein 18, TAZ1, TAZ-1Zinc finger protein C2H2-171, Transcriptional repressor RP58, Translin-associated zinc finger protein 1, ZBTB1858 kDa repressor protein, zinc finger protein 238

Gene Symbol

ZNF498

UniProt

Q6NSZ9 (Human)

Additional ZNF498 Products

Product Documents for ZNF498 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ZNF498 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ZNF498 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ZNF498 Antibody - BSA Free and earn rewards!

Have you used ZNF498 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies