ZNF645 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35872

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ZNF645 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 346-425 of human ZNF645 (NP_689790.1).

Sequence:
QNGNPSASEFASHHYNLNILPQFTENQETLSPQFTQTDAMDHRRWPAWKRLSPCPPTRSPPPSTLHGRSHHSHQRRHRRY

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

49 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ZNF645 Antibody - BSA Free

ZNF645 Antibody

Western Blot: ZNF645 Antibody [NBP3-35872] -

Western Blot: ZNF645 Antibody [NBP3-35872] - Western blot analysis of various lysates using ZNF645 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.

Applications for ZNF645 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ZNF645

ZNF645 is a gene that codes for a protein that is an E3 ubiquitin ligase that facilitates the covalent attachment of ubiquitin moieties onto substrate proteins, and is 425 amino acids long and has a weight of approximately 49 kDa. ZNF645 has been shown to have interactions with UBC.

Alternate Names

CBLL2, E3 ubiquitin ligase, HAKAIL, zinc finger protein 645

Gene Symbol

ZNF645

Additional ZNF645 Products

Product Documents for ZNF645 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ZNF645 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ZNF645 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ZNF645 Antibody - BSA Free and earn rewards!

Have you used ZNF645 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies