ZP2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-93167

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 651-745 of human ZP2 (NP_003451.1). KMTVSLPGPILLLSDDSSFRGVGSSDLKASGSSGEKSRSETGEEVGSRGAMDTKGHKTAGDVGSKAVAAVAAFAGVVATLGFIYYLYEKRTVSNH

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

82 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ZP2 Antibody - BSA Free

Western Blot: ZP2 AntibodyBSA Free [NBP2-93167]

Western Blot: ZP2 AntibodyBSA Free [NBP2-93167]

Western Blot: ZP2 Antibody [NBP2-93167] - Analysis of extracts of various cell lines, using ZP2 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
ZP2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ZP2 Antibody - BSA Free [NBP2-93167] -

Immunocytochemistry/ Immunofluorescence: ZP2 Antibody - BSA Free [NBP2-93167] - Immunofluorescence analysis of rat ovary cells using ZP2 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
ZP2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ZP2 Antibody - BSA Free [NBP2-93167] -

Immunocytochemistry/ Immunofluorescence: ZP2 Antibody - BSA Free [NBP2-93167] - Immunofluorescence analysis of Human ovarian cancer cells using ZP2 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
ZP2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ZP2 Antibody - BSA Free [NBP2-93167] -

Immunocytochemistry/ Immunofluorescence: ZP2 Antibody - BSA Free [NBP2-93167] - Immunofluorescence analysis of mouse ovary cells using ZP2 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Applications for ZP2 Antibody - BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL.

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:1000-1:4000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ZP2

The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. The protein encoded by this gene is a structural component of the zona pellucida and functions in secondary binding and penetration of acrosome-reacted spermatozoa. The nascent protein contains a N-terminal signal peptide sequence, a conserved ZP domain, a consensus furin cleavage site, and a C-terminal transmembrane domain. It is hypothesized that furin cleavage results in release of the mature protein from the plasma membrane for subsequent incorporation into the zona pellucida matrix. However, the requirement for furin cleavage in this process remains controversial based on mouse studies. [provided by RefSeq]

Long Name

Zona Pellucida Glycoprotein 2 (Sperm Receptor)

Alternate Names

Zona Pellucida Protein A, Zp-2, ZPA

Gene Symbol

ZP2

Additional ZP2 Products

Product Documents for ZP2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ZP2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ZP2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ZP2 Antibody - BSA Free and earn rewards!

Have you used ZP2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...