14-3-3 beta/alpha Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80611

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Cited:

Mouse

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: ICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for 14-3-3 beta/alpha Antibody - BSA Free

Immunohistochemistry-Paraffin: 14-3-3 beta/alpha Antibody [NBP1-80611]

Immunohistochemistry-Paraffin: 14-3-3 beta/alpha Antibody [NBP1-80611]

Immunohistochemistry-Paraffin: 14-3-3 beta/alpha Antibody [NBP1-80611] - Analysis in human cerebral cortex and pancreas tissues. Corresponding YWHAB RNA-seq data are presented for the same tissues.
Western Blot: 14-3-3 beta/alpha Antibody [NBP1-80611]

Western Blot: 14-3-3 beta/alpha Antibody [NBP1-80611]

Western Blot: 14-3-3 beta/alpha Antibody [NBP1-80611] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: 14-3-3 beta/alpha Antibody [NBP1-80611]

Immunohistochemistry-Paraffin: 14-3-3 beta/alpha Antibody [NBP1-80611]

Immunohistochemistry-Paraffin: 14-3-3 beta/alpha Antibody [NBP1-80611] - Staining of human pancreas shows very weak positivity in exocrine glandular cells as expected.
Western Blot: 14-3-3 beta/alpha Antibody [NBP1-80611]

Western Blot: 14-3-3 beta/alpha Antibody [NBP1-80611]

Western Blot: 14-3-3 beta/alpha Antibody [NBP1-80611] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: 14-3-3 beta/alpha Antibody [NBP1-80611]

Immunohistochemistry-Paraffin: 14-3-3 beta/alpha Antibody [NBP1-80611]

Immunohistochemistry-Paraffin: 14-3-3 beta/alpha Antibody [NBP1-80611] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: 14-3-3 beta/alpha Antibody [NBP1-80611]

Immunohistochemistry-Paraffin: 14-3-3 beta/alpha Antibody [NBP1-80611]

Immunohistochemistry-Paraffin: 14-3-3 beta/alpha Antibody [NBP1-80611] - Staining of human cerebellum shows moderate to strong cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: 14-3-3 beta/alpha Antibody [NBP1-80611]

Immunohistochemistry-Paraffin: 14-3-3 beta/alpha Antibody [NBP1-80611]

Immunohistochemistry-Paraffin: 14-3-3 beta/alpha Antibody [NBP1-80611] - Staining of human skin shows moderate to strong cytoplasmic positivity in epidermal cells.

Applications for 14-3-3 beta/alpha Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: 14-3-3 beta/alpha

The 14-3-3 proteins are a family of proteins involved in the regulation of apoptosis, mitogenic signaling and cell-cycle checkpoints. The 14-3-3 proteins are thought to be key regulators of signal transduction events mediated through their binding to serine-phosphorylated proteins. Through binding Bad, 14-3-3 prevents apoptosis by sequestering Bad to the cytosol.

Alternate Names

14-3-3 alpha, 14-3-3 beta, 14-3-3 protein beta/alpha, brain protein 14-3-3, beta isoform, GW128, HS1, KCIP-1, Protein 1054, Protein kinase C inhibitor protein 1, protein kinase C inhibitor protein-1, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, alphapolypeptide, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, betapolypeptide, YWHAA

Entrez Gene IDs

7529 (Human)

Gene Symbol

YWHAB

UniProt

Additional 14-3-3 beta/alpha Products

Product Documents for 14-3-3 beta/alpha Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for 14-3-3 beta/alpha Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for 14-3-3 beta/alpha Antibody - BSA Free

Customer Reviews for 14-3-3 beta/alpha Antibody - BSA Free

There are currently no reviews for this product. Be the first to review 14-3-3 beta/alpha Antibody - BSA Free and earn rewards!

Have you used 14-3-3 beta/alpha Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...