17 beta-HSD1/HSD17B1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-39053

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: ALDPSQSFKVYATLRDLKTQGRLWEAARALACPQG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for 17 beta-HSD1/HSD17B1 Antibody - BSA Free

Immunohistochemistry-Paraffin: 17 beta-HSD1/HSD17B1 Antibody [NBP2-39053]

Immunohistochemistry-Paraffin: 17 beta-HSD1/HSD17B1 Antibody [NBP2-39053]

Immunohistochemistry-Paraffin: 17 beta-HSD1/HSD17B1 Antibody [NBP2-39053] - Staining in human placenta and prostate tissues using anti-HSD17B1 antibody. Corresponding HSD17B1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: 17 beta-HSD1/HSD17B1 Antibody [NBP2-39053]

Immunohistochemistry-Paraffin: 17 beta-HSD1/HSD17B1 Antibody [NBP2-39053]

Immunohistochemistry-Paraffin: 17 beta-HSD1/HSD17B1 Antibody [NBP2-39053] - Staining of human cerebral cortex, lymph node, placenta and prostate using Anti-HSD17B1 antibody NBP2-39053 (A) shows similar protein distribution across tissues to independent antibody NBP1-84901 (B).
Immunohistochemistry-Paraffin: 17 beta-HSD1/HSD17B1 Antibody [NBP2-39053]

Immunohistochemistry-Paraffin: 17 beta-HSD1/HSD17B1 Antibody [NBP2-39053]

Immunohistochemistry-Paraffin: 17 beta-HSD1/HSD17B1 Antibody [NBP2-39053] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: 17 beta-HSD1/HSD17B1 Antibody [NBP2-39053]

Immunohistochemistry-Paraffin: 17 beta-HSD1/HSD17B1 Antibody [NBP2-39053]

Immunohistochemistry-Paraffin: 17 beta-HSD1/HSD17B1 Antibody [NBP2-39053] - Staining of human placenta shows high expression.
Immunohistochemistry-Paraffin: 17 beta-HSD1/HSD17B1 Antibody [NBP2-39053]

Immunohistochemistry-Paraffin: 17 beta-HSD1/HSD17B1 Antibody [NBP2-39053]

Immunohistochemistry-Paraffin: 17 beta-HSD1/HSD17B1 Antibody [NBP2-39053] - Staining of human prostate shows low expression as expected.
Immunohistochemistry-Paraffin: 17 beta-HSD1/HSD17B1 Antibody [NBP2-39053]

Immunohistochemistry-Paraffin: 17 beta-HSD1/HSD17B1 Antibody [NBP2-39053]

Immunohistochemistry-Paraffin: 17 beta-HSD1/HSD17B1 Antibody [NBP2-39053] - Staining of human lymph node.

Applications for 17 beta-HSD1/HSD17B1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: 17 beta-HSD1/HSD17B1

The principal human estrogen, 17 beta-estradiol, is a potent stimulator of certain endocrine-dependent forms of breast cancer. Because human estrogenic 17 beta-hydroxysteroid dehydrogenase (HSD17B1) catalyzes the last step in the biosynthesis of 17 beta-estradiol from the less potent estrogen, estrone, it is an attractive target for the design of inhibitors of estrogen production and tumor growth (1). It is concluded that the steroid-binding site of human placental HSD17B1 contains a histidine residue which proximates the upper A-ring region of the steroid as it undergoes the reversible binding step (2). Human estrogenic HSD17B1 is an NADP(H)-preferring enzyme. It possesses 11- and 4-fold higher specificity toward NADP(H) over NAD(H) for oxidation and reduction, respectively, as demonstrated by kinetic studies (3). Defects in the conversion of androstenedione to testosterone in the fetal testes by the enzyme HSD17B1 give rise to genetic males with female external genitalia (4)

Long Name

17 beta Hydroxysteroid Dehydrogenase 1

Alternate Names

17 betaHSD1, E2DH, EDH17B2, EDHB17, HSD17B1, SDR28C1

Gene Symbol

HSD17B1

UniProt

Additional 17 beta-HSD1/HSD17B1 Products

Product Documents for 17 beta-HSD1/HSD17B1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for 17 beta-HSD1/HSD17B1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for 17 beta-HSD1/HSD17B1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review 17 beta-HSD1/HSD17B1 Antibody - BSA Free and earn rewards!

Have you used 17 beta-HSD1/HSD17B1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...