Aconitase 1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-87677
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Validated:
Human, Mouse, Rat
Cited:
Human, Rat
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YERIHRSNLVGMGVIPLEYLPGENADALGLTGQERYTIIIPENLKPQMKVQVKLDTGKTFQAVMRFDTDVELTYFLNGGILNYMIRKMAK
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Aconitase 1 Antibody - BSA Free
Western Blot: Aconitase 1 Antibody [NBP1-87677]
Aconitase-1-Antibody-Western-Blot-NBP1-87677-img0023.jpgImmunocytochemistry/ Immunofluorescence: Aconitase 1 Antibody [NBP1-87677]
Immunocytochemistry/Immunofluorescence: Aconitase 1 Antibody [NBP1-87677] - Staining of human cell line U-2 OS shows localization to cytosol & mitochondria. Antibody staining is shown in green.Western Blot: Aconitase 1 Antibody [NBP1-87677]
Western Blot: Aconitase 1 Antibody [NBP1-87677] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.Western Blot: Aconitase 1 Antibody [NBP1-87677]
Aconitase-1-Antibody-Western-Blot-NBP1-87677-img0024.jpgImmunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP1-87677]
Immunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP1-87677] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.Immunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP1-87677] -
Immunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP1-87677] -Staining of human skeletal muscle shows no positivity in myocytes as expected.Western Blot: Aconitase 1 Antibody [NBP1-87677] -
Western Blot: Aconitase 1 Antibody [NBP1-87677] - Effect of HFD on IRP1.A) Total IRP1 activity was measured by RNA band shift assay. B) Densitometric analysis of IRP1 activity. C) Hepatic IRP1 protein levels evaluated by Western Blotting. C) Densitometric analysis of IRP1 protein levels; beta -actin is shown as the loading control. D). Effect of HFD on IRP1 & IRP2 mRNA levels. Gene expression was evaluated by qRT-PCR. The figure is representative of results obtained in 6 animals per group in two independent experiments. Values are expressed as means±SD. AU, arbitrary units. *p<0.05 vs controls. Image collected & cropped by CiteAb from the following publication (https://dx.plos.org/10.1371/journal.pone.0116855), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for Aconitase 1 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25 - 2 ug/mL
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Western Blot
0.04 - 0.4 ug/mL
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100.
Reviewed Applications
Read 2 reviews rated 2.5 using NBP1-87677 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Aconitase 1
Alternate Names
Aconitase, aconitase 1, soluble, aconitate hydratase, Citrate hydro-lyase, cytoplasmic aconitate hydratase, EC 4.2.1, EC 4.2.1.3, Ferritin repressor protein, IREB1IREBP1, IREBP, IRE-BP 1, Iron regulatory protein 1, iron-responsive element binding protein 1, Iron-responsive element-binding protein 1, IRP1ACONS
Gene Symbol
ACO1
Additional Aconitase 1 Products
Product Documents for Aconitase 1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Aconitase 1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for Aconitase 1 Antibody - BSA Free
Customer Reviews for Aconitase 1 Antibody - BSA Free (2)
2.5 out of 5
2 Customer Ratings
Have you used Aconitase 1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Customer Images
Showing
1
-
2 的
2 reviews
Showing All
Filter By:
-
Application: Western BlotSample Tested: Purified protein and Whole organism protein extractSpecies: Bovine and Chironomus ripriusVerified Customer | Posted 03/09/2020Visualization of nitrocellulose membrane from 10% SDS-PAGE gel for ladder, bovine heart aconitase, and whole organism protein extract from Chironomus riparius larvae. IR anti-rabbit secondary antibody. NBP1-87677 gives only non-specific bands.Bio-Techne ResponseThis review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.
-
Application: Western BlotSample Tested: mouse lungSpecies: MouseVerified Customer | Posted 07/28/2014
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...