ACOT7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89279

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (93%), Rat (95%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: NKSMEIEVLVDADPVVDSSQKRYRAASAFFTYVSLSQEGRSLPVPQLVPETEDEKKRFEEGKGRYLQMKAKRQGH

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ACOT7 Antibody - BSA Free

Western Blot: ACOT7 Antibody [NBP1-89279]

Western Blot: ACOT7 Antibody [NBP1-89279]

Western Blot: ACOT7 Antibody [NBP1-89279] - Analysis using Anti-ACOT7 antibody NBP1-89279 (A) shows similar pattern to independent antibody NBP1-89278 (B).
Immunohistochemistry-Paraffin: ACOT7 Antibody [NBP1-89279]

Immunohistochemistry-Paraffin: ACOT7 Antibody [NBP1-89279]

Immunohistochemistry-Paraffin: ACOT7 Antibody [NBP1-89279] - Staining of human cerebellum, cerebral cortex, kidney and pancreas using Anti-ACOT7 antibody NBP1-89279 (A) shows similar protein distribution across tissues to independent antibody NBP1-89278 (B).
Western Blot: ACOT7 Antibody [NBP1-89279]

Western Blot: ACOT7 Antibody [NBP1-89279]

Western Blot: ACOT7 Antibody [NBP1-89279] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-16
Immunohistochemistry-Paraffin: ACOT7 Antibody [NBP1-89279]

Immunohistochemistry-Paraffin: ACOT7 Antibody [NBP1-89279]

Immunohistochemistry-Paraffin: ACOT7 Antibody [NBP1-89279] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
Immunohistochemistry-Paraffin: ACOT7 Antibody [NBP1-89279]

Immunohistochemistry-Paraffin: ACOT7 Antibody [NBP1-89279]

Immunohistochemistry-Paraffin: ACOT7 Antibody [NBP1-89279] - Staining of human cerebral cortex shows strong positivity in neurons and neuropil.
Immunohistochemistry-Paraffin: ACOT7 Antibody [NBP1-89279]

Immunohistochemistry-Paraffin: ACOT7 Antibody [NBP1-89279]

Immunohistochemistry-Paraffin: ACOT7 Antibody [NBP1-89279] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: ACOT7 Antibody [NBP1-89279]

Immunohistochemistry-Paraffin: ACOT7 Antibody [NBP1-89279]

Immunohistochemistry-Paraffin: ACOT7 Antibody [NBP1-89279] - Staining of human pancreas shows weak to no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: ACOT7 Antibody [NBP1-89279]

Immunohistochemistry-Paraffin: ACOT7 Antibody [NBP1-89279]

Immunohistochemistry-Paraffin: ACOT7 Antibody [NBP1-89279] - Staining in human cerebral cortex and pancreas tissues. Corresponding ACOT7 RNA-seq data are presented for the same tissues.

Applications for ACOT7 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACOT7

The ACOT7 gene encodes a member of the acyl coenzyme family. The encoded protein hydrolyzes the CoA thioester ofpalmitoyl-CoA and other long-chain fatty acids. Decreased expression of this gene may be associated with mesialtemporal lobe epilepsy. Alternatively

Alternate Names

ACH1, acyl-CoA thioesterase 7CTE-IIa, BACHEC 3.1.2.2, brain acyl CoA hydrolase, Brain acyl-CoA hydrolase, CTE-IILACH, cytosolic acyl coenzyme A thioester hydrolase, hBACH, long chain, Long chain acyl-CoA thioester hydrolase

Gene Symbol

ACOT7

Additional ACOT7 Products

Product Documents for ACOT7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ACOT7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ACOT7 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ACOT7 Antibody - BSA Free and earn rewards!

Have you used ACOT7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...