Adenosine Deaminase/ADA Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-90361

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: QVELHVHLDGSIKPETILYYGRRRGIALPANTAEGLLNVIGMDKPLTLPDFLAKFDYYMPAIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVALVGQGLQEGERDFGVKARSILCC

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (88%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Adenosine Deaminase/ADA Antibody - BSA Free

Adenosine Deaminase/ADA Antibody Immunohistochemistry-Paraffin: Adenosine Deaminase/ADA Antibody Antibody [NBP1-90361]

Immunohistochemistry-Paraffin: Adenosine Deaminase/ADA Antibody Antibody [NBP1-90361]

Staining of human duodenum, small intestine, stomach and testis using NBP1-90361 (A) shows similar protein distribution across tissues to independent antibody NBP1-87404 (B).
Adenosine Deaminase/ADA Antibody - BSA Free Immunohistochemistry: Adenosine Deaminase/ADA Antibody - BSA Free [NBP1-90361]

Immunohistochemistry: Adenosine Deaminase/ADA Antibody - BSA Free [NBP1-90361]

Analysis in human duodenum and testis tissues using NBP1-90361 antibody. Corresponding ADA RNA-seq data are presented for the same tissues.
Adenosine Deaminase/ADA Antibody - BSA Free Immunohistochemistry: Adenosine Deaminase/ADA Antibody - BSA Free [NBP1-90361]

Immunohistochemistry: Adenosine Deaminase/ADA Antibody - BSA Free [NBP1-90361]

Staining of human duodenum shows strong membranous and cytoplasmic positivity in glandular cells.
Adenosine Deaminase/ADA Antibody - BSA Free Immunohistochemistry: Adenosine Deaminase/ADA Antibody - BSA Free [NBP1-90361]

Immunohistochemistry: Adenosine Deaminase/ADA Antibody - BSA Free [NBP1-90361]

Staining of human testis shows weak cytoplasmic positivity in cells in Leydig cells.
Adenosine Deaminase/ADA Antibody - BSA Free Immunohistochemistry: Adenosine Deaminase/ADA Antibody - BSA Free [NBP1-90361]

Immunohistochemistry: Adenosine Deaminase/ADA Antibody - BSA Free [NBP1-90361]

Staining of human small intestine shows strong membranous and cytoplasmic positivity in glandular cells.
Adenosine Deaminase/ADA Antibody - BSA Free Immunohistochemistry: Adenosine Deaminase/ADA Antibody - BSA Free [NBP1-90361]

Immunohistochemistry: Adenosine Deaminase/ADA Antibody - BSA Free [NBP1-90361]

Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.
Adenosine Deaminase/ADA Antibody - BSA Free Western Blot: Adenosine Deaminase/ADA Antibody - BSA Free [NBP1-90361]

Western Blot: Adenosine Deaminase/ADA Antibody - BSA Free [NBP1-90361]

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue

Applications for Adenosine Deaminase/ADA Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:5000 - 1:10000

Immunohistochemistry-Paraffin

1:5000 - 1:10000

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Adenosine Deaminase/ADA

Adenosine deaminase is an enzyme involved in purine metabolism. It is needed for the breakdown of adenosine from food and from the turnover of nucleic acids in tissues. It irreversibly deaminates adenosine, converting it to the related nucleoside inosine by the removal of an amine group. Inosine can then be deribosylated (removed from ribose) by another enzyme called purine nucleoside phosphorylase (PNP), converting it to hypoxanthine. Mutations in the gene for adenosine deaminase causing it to not be expressed are one cause of severe combined immunodeficiency (SCID). Mutations causing it to be overexpressed are one cause of hemolytic anemia. There is some evidence that a different allelle (ADA2) may lead to autism. There are 2 isoforms of ADA: ADA1 and ADA2. ADA1 is found in most body cells, particularly lymphocytes and macrophages, where it is present not only in the cytosol but also as the ecto- form on the cell membrane attached to a protein called CD26. ADA2 has only been found in the macrophage where it co-exists with ADA1 where the two isoforms regulate the ratio of adenosine to deoxyadenosine to potentiate the killing of parasites. ADA2 is the predominant form present in human plasma and is increased in many diseases, particularly those associated with the immune system: for example rheumatoid arthritis, psoriasis and sarcoidosis. The plasma AD2 isoform is also increased in most cancers.

Long Name

Adenosine Aminohydrolase

Alternate Names

ADA, ADA1

Gene Symbol

ADA

Additional Adenosine Deaminase/ADA Products

Product Documents for Adenosine Deaminase/ADA Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Adenosine Deaminase/ADA Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Adenosine Deaminase/ADA Antibody - BSA Free

Customer Reviews for Adenosine Deaminase/ADA Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Adenosine Deaminase/ADA Antibody - BSA Free and earn rewards!

Have you used Adenosine Deaminase/ADA Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Adenosine Deaminase/ADA Antibody - BSA Free

Showing  1 - 11 FAQ Showing All
  • Q: On your web-page there is a western blot analysis of different cell lines with expressed ADA (if I understand correctly). Why there are two arrowheads for ADA, what is in the second band detected by your antibody?

    A: ADA seems to run at many different sizes. Our Application Notes for another ADA antibody states: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. In some tissues ADA1 also exists as a monomer and a dimer form, whereas, and the isoform ADA2 only exists as a monomer. So we cannot say exactly what the band is but we know it is a different size due to post translational modification.

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies
Loading...