Adenylosuccinate Synthase Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-90360

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KLDGEIIPHIPANQEVLNKVEVQYKTLPGWNTDISNARAFKELPVNAQNYVRFIEDELQIPVKWIGVGKSRESM

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Adenylosuccinate Synthase Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Adenylosuccinate Synthase Antibody [NBP1-90360]

Immunocytochemistry/ Immunofluorescence: Adenylosuccinate Synthase Antibody [NBP1-90360]

Immunocytochemistry/Immunofluorescence: Adenylosuccinate Synthase Antibody [NBP1-90360] - Staining of human cell line U-251 MG shows localization to plasma membrane and cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Adenylosuccinate Synthase Antibody [NBP1-90360]

Immunohistochemistry-Paraffin: Adenylosuccinate Synthase Antibody [NBP1-90360]

Immunohistochemistry-Paraffin: Adenylosuccinate Synthase Antibody [NBP1-90360] - Analysis in human testis and skeletal muscle tissues. Corresponding ADSS RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Adenylosuccinate Synthase Antibody [NBP1-90360]

Immunohistochemistry-Paraffin: Adenylosuccinate Synthase Antibody [NBP1-90360]

Immunohistochemistry-Paraffin: Adenylosuccinate Synthase Antibody [NBP1-90360] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Adenylosuccinate Synthase Antibody - BSA Free Immunohistochemistry: Adenylosuccinate Synthase Antibody - BSA Free [NBP1-90360]

Immunohistochemistry: Adenylosuccinate Synthase Antibody - BSA Free [NBP1-90360]

Staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: Adenylosuccinate Synthase Antibody [NBP1-90360]

Immunohistochemistry-Paraffin: Adenylosuccinate Synthase Antibody [NBP1-90360]

Immunohistochemistry-Paraffin: Adenylosuccinate Synthase Antibody [NBP1-90360] - Staining of human rectum shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Adenylosuccinate Synthase Antibody [NBP1-90360]

Immunohistochemistry-Paraffin: Adenylosuccinate Synthase Antibody [NBP1-90360]

Immunohistochemistry-Paraffin: Adenylosuccinate Synthase Antibody [NBP1-90360] - Staining of human prostate shows moderate cytoplasmic and membranous positivity in glandular cells.
Adenylosuccinate Synthase Antibody - BSA Free Western Blot: Adenylosuccinate Synthase Antibody - BSA Free [NBP1-90360]

Western Blot: Adenylosuccinate Synthase Antibody - BSA Free [NBP1-90360]

Analysis in human cell line A-431.

Applications for Adenylosuccinate Synthase Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20-1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Adenylosuccinate Synthase

Adenylosuccinate synthetase catalyzes the first committed step in the conversion of IMP to AMP [provided by RefSeq]

Alternate Names

ADEH, adenylosuccinate synthase, adenylosuccinate synthetase (Ade(-)H-complementing), adenylosuccinate synthetase isozyme 2, Adenylosuccinate synthetase, acidic isozyme, Adenylosuccinate synthetase, liver isozyme, AdSS 2, ADSS2, AMPSase 2, EC 6.3.4.4, IMP--aspartate ligase 2, L-type adenylosuccinate synthetase, MGC20404

Entrez Gene IDs

159 (Human)

Gene Symbol

ADSS2

UniProt

Additional Adenylosuccinate Synthase Products

Product Documents for Adenylosuccinate Synthase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Adenylosuccinate Synthase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Adenylosuccinate Synthase Antibody - BSA Free

Customer Reviews for Adenylosuccinate Synthase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Adenylosuccinate Synthase Antibody - BSA Free and earn rewards!

Have you used Adenylosuccinate Synthase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...