AKR1B1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89146

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: CTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNV

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (80%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for AKR1B1 Antibody - BSA Free

Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146]

Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146]

Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146]

Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146]

Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146]

Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146]

Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Analysis in human adrenal gland and liver tissues. Corresponding AKR1B1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146]

Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146]

Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Staining of human adrenal gland shows moderate to strong cytoplasmic and nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146]

Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146]

Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry: AKR1B1 Antibody [NBP1-89146]

Immunohistochemistry: AKR1B1 Antibody [NBP1-89146]

Immunohistochemistry: AKR1B1 Antibody [NBP1-89146] - Staining of human colon shows no positivity in glandular cells as expected.
AKR1B1 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: AKR1B1 Antibody [NBP1-89146]

Immunocytochemistry/ Immunofluorescence: AKR1B1 Antibody [NBP1-89146]

Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.

Applications for AKR1B1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: AKR1B1

Aldose reductase (also designated AKR1B1, ALDR1, ALR2 or AR) is member of the monomeric NADPH-dependent aldoketoreductase family. Aldose reductase, which has a molecular mass of 36 kDa, catalyzes the reduction of various aldehydes and has been implicated in the development of diabetic complications by catalyzing the reduction of the aldehyde form of glucose, to the corresponding sugar alcohol, sorbitol. This pathway plays a minor role in glucose metabolism in most tissues, however in diabetic hyperglycemia, cells undergoing insulin-independent uptake of glucose accumulate significant quantities of sorbitol. The resulting hyperosmotic stress to cells may be a cause of diabetic complications such as neuropathy, retinopathy, and cataracts. Aldose reductase is very similar to human aldehyde reductase, bovine prostaglandin F synthase and to the European common frog protein, rho-crystallin.

Alternate Names

ADR, Aldehyde reductase, Aldo-keto reductase family 1 member B1, aldo-keto reductase family 1, member B1 (aldose reductase), ALDR1aldose reductase, ALR2, ARaldehyde reductase 1, EC 1.1.1, EC 1.1.1.21, Lii5-2 CTCL tumor antigen, low Km aldose reductase, MGC1804

Gene Symbol

AKR1B1

Additional AKR1B1 Products

Product Documents for AKR1B1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for AKR1B1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for AKR1B1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review AKR1B1 Antibody - BSA Free and earn rewards!

Have you used AKR1B1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for AKR1B1 Antibody - BSA Free

Showing  1 - 11 FAQ Showing All
  • Q: I study in HKBU and want to buy some antibodies (an anti-AKR1B1 and anti-AKR1B1). I found that there are different kinds of AKR1B1 (AR) and AKR1B10 (ARL-1) antibodies in your company. Do these antibodies cross-react with each other? Could you give me some advice about how I choose antibodies with the minimum cross-reactivity?

    A:

    Here is a link to our antibodies to AKR1B1. The cross-reactivity of these against AKR1B10 is not given and so I ran alignments against the AKR1B10 sequence for you in the instances where the immunogen sequence was disclosed. In all of these cases the homology was greater than 90%, so you would be likely to see cross-reactivity with the AKR1B10 protein. I also ran an alignment between the full length sequences of AKR1B1 and AKR1B10 and found that the homology between these two proteins is 70%. Please see this link for our AKR1B10 primary antibodies. Of these, the immunogen used to generate NBP1-44998 is listed as a highly specific 15 amino acid portion of human AKR1B10 (within amino acids 100-150). [UniProt# O60218]. This may be a suitable choice for you when detecting AKR1B10.

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies
Loading...