AKR1C2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35145

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-323 of human AKR1C2 (NP_995317.1).

Sequence:
MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for AKR1C2 Antibody - BSA Free

AKR1C2 Antibody

Immunocytochemistry/ Immunofluorescence: AKR1C2 Antibody [NBP3-35145] -

Immunocytochemistry/ Immunofluorescence: AKR1C2 Antibody [NBP3-35145] - Immunofluorescence analysis of L929 cells using AKR1C2 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
AKR1C2 Antibody

Western Blot: AKR1C2 Antibody [NBP3-35145] -

Western Blot: AKR1C2 Antibody [NBP3-35145] - Western blot analysis of various lysates, using AKR1C2 Rabbit pAb at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
AKR1C2 Antibody

Immunohistochemistry: AKR1C2 Antibody [NBP3-35145] -

Immunohistochemistry: AKR1C2 Antibody [NBP3-35145] - Immunohistochemistry analysis of paraffin-embedded Human Colon cancer using AKR1C2 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
AKR1C2 Antibody

Immunocytochemistry/ Immunofluorescence: AKR1C2 Antibody [NBP3-35145] -

Immunocytochemistry/ Immunofluorescence: AKR1C2 Antibody [NBP3-35145] - Immunofluorescence analysis of U-2 OS cells using AKR1C2 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
AKR1C2 Antibody

Immunohistochemistry: AKR1C2 Antibody [NBP3-35145] -

Immunohistochemistry: AKR1C2 Antibody [NBP3-35145] - Immunohistochemistry analysis of paraffin-embedded Mouse liver using AKR1C2 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
AKR1C2 Antibody

Immunohistochemistry: AKR1C2 Antibody [NBP3-35145] -

Immunohistochemistry: AKR1C2 Antibody [NBP3-35145] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer using AKR1C2 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
AKR1C2 Antibody

Immunohistochemistry: AKR1C2 Antibody [NBP3-35145] -

Immunohistochemistry: AKR1C2 Antibody [NBP3-35145] - Immunohistochemistry analysis of paraffin-embedded Rat liver using AKR1C2 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Applications for AKR1C2 Antibody - BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL

Immunocytochemistry/ Immunofluorescence

1:50 - 1:100

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:1000 - 1:5000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: AKR1C2

AKR1C2 encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme binds bile acid with high affinity, and shows minimal 3-alpha-hydroxysteroid dehydrogenase activity. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14.

Alternate Names

aldo-keto reductase family 1 member C2, aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acidbinding protein; 3-alpha hydroxysteroid dehydrogenase, type III), BABP, Chlordecone reductase homolog HAKRD, DD, DD-2, DD2DD/BABP, DDH2FLJ53800, Dihydrodiol dehydrogenase 2, Dihydrodiol dehydrogenase/bile acid-binding protein, EC 1.1.1,3-alpha-HSD3, EC 1.1.1.213, EC 1.3.1.20, HAKRDAKR1C-pseudo, HBAB, MCDR2, pseudo-chlordecone reductase, Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase, type II dihydrodiol dehydrogenase, Type III 3-alpha-hydroxysteroid dehydrogenase

Gene Symbol

AKR1C2

Additional AKR1C2 Products

Product Documents for AKR1C2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for AKR1C2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for AKR1C2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review AKR1C2 Antibody - BSA Free and earn rewards!

Have you used AKR1C2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...