ALDH6A1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-82637

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SCKRAFPAWADTSVLSRQQVLLRYQQLIKENLKEIAKLITLEQGKTLADAEGDVFRGLQVVEHACSVTSLMMGETMPSIT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ALDH6A1 Antibody - BSA Free

Western Blot: ALDH6A1 Antibody [NBP1-82637]

Western Blot: ALDH6A1 Antibody [NBP1-82637]

Western Blot: ALDH6A1 Antibody [NBP1-82637] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: ALDH6A1 Antibody [NBP1-82637]

Immunohistochemistry-Paraffin: ALDH6A1 Antibody [NBP1-82637]

Immunohistochemistry-Paraffin: ALDH6A1 Antibody [NBP1-82637] - Staining of human testis.
Western Blot: ALDH6A1 Antibody [NBP1-82637]

Western Blot: ALDH6A1 Antibody [NBP1-82637]

Western Blot: ALDH6A1 Antibody [NBP1-82637] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted)
Immunohistochemistry-Paraffin: ALDH6A1 Antibody [NBP1-82637]

Immunohistochemistry-Paraffin: ALDH6A1 Antibody [NBP1-82637]

Immunohistochemistry-Paraffin: ALDH6A1 Antibody [NBP1-82637] - Staining of human liver shows strong cytoplasmic positivity with a granular pattern in hepatocytes.
Immunohistochemistry-Paraffin: ALDH6A1 Antibody [NBP1-82637]

Immunohistochemistry-Paraffin: ALDH6A1 Antibody [NBP1-82637]

Immunohistochemistry-Paraffin: ALDH6A1 Antibody [NBP1-82637] - Staining of human tonsil shows low expression as expected.
Immunohistochemistry-Paraffin: ALDH6A1 Antibody [NBP1-82637]

Immunohistochemistry-Paraffin: ALDH6A1 Antibody [NBP1-82637]

Immunohistochemistry-Paraffin: ALDH6A1 Antibody [NBP1-82637] - Staining in human liver and tonsil tissues using anti-ALDH6A1 antibody. Corresponding ALDH6A1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ALDH6A1 Antibody [NBP1-82637]

Immunohistochemistry-Paraffin: ALDH6A1 Antibody [NBP1-82637]

Immunohistochemistry-Paraffin: ALDH6A1 Antibody [NBP1-82637] - Staining of human cerebral cortex, kidney, liver and testis using Anti-ALDH6A1 antibody NBP1-82637 (A) shows similar protein distribution across tissues to independent antibody NBP1-82635 (B).
Immunohistochemistry-Paraffin: ALDH6A1 Antibody [NBP1-82637]

Immunohistochemistry-Paraffin: ALDH6A1 Antibody [NBP1-82637]

Immunohistochemistry-Paraffin: ALDH6A1 Antibody [NBP1-82637] - Staining of human kidney.
Immunohistochemistry-Paraffin: ALDH6A1 Antibody [NBP1-82637]

Immunohistochemistry-Paraffin: ALDH6A1 Antibody [NBP1-82637]

Immunohistochemistry-Paraffin: ALDH6A1 Antibody [NBP1-82637] - Staining of human cerebral cortex.

Applications for ALDH6A1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ALDH6A1

ALDH6A1 belongs to the aldehyde dehydrogenases family of proteins. This enzyme plays a role in the valine and pyrimidine catabolic pathways. The product of this gene, a mitochondrial methylmalonate semialdehyde dehydrogenase, catalyzes the irreversible oxidative decarboxylation of malonate and methylmalonate semialdehydes to acetyl- and propionyl-CoA. Methylmalonate semialdehyde dehydrogenase deficiency is characterized by elevated beta-alanine, 3-hydroxypropionic acid, and both isomers of 3-amino and 3-hydroxyisobutyric acids in urine organic acids.

Alternate Names

aldehyde dehydrogenase 6 family, member A1, Aldehyde dehydrogenase family 6 member A1, EC 1.2.1.18, EC 1.2.1.27, malonate-semialdehyde dehydrogenase, Malonate-semialdehyde dehydrogenase [acylating], methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial, MGC40271, MMSADHA, MMSDHmitochondrial acylating methylmalonate-semialdehyde dehydrogenase

Gene Symbol

ALDH6A1

Additional ALDH6A1 Products

Product Documents for ALDH6A1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ALDH6A1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ALDH6A1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ALDH6A1 Antibody - BSA Free and earn rewards!

Have you used ALDH6A1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...