Aldo-keto Reductase 1B10/AKR1B10 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89161

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: PTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKAT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Aldo-keto Reductase 1B10/AKR1B10 Antibody - BSA Free

Western Blot: Aldo-keto Reductase 1B10/AKR1B10 Antibody [NBP1-89161]

Western Blot: Aldo-keto Reductase 1B10/AKR1B10 Antibody [NBP1-89161]

Western Blot: Aldo-keto Reductase 1B10/AKR1B10 Antibody [NBP1-89161] - Analysis in human cell lines A-549 and HEK293 using anti-AKR1B10 antibody. Corresponding AKR1B10 RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.
Immunohistochemistry-Paraffin: Aldo-keto Reductase 1B10/AKR1B10 Antibody [NBP1-89161]

Immunohistochemistry-Paraffin: Aldo-keto Reductase 1B10/AKR1B10 Antibody [NBP1-89161]

Immunohistochemistry-Paraffin: Aldo-keto Reductase 1B10/AKR1B10 Antibody [NBP1-89161] - Staining of human small intestine shows strong cytoplasmic, nuclear and membranous positivity in glandular cells.
Western Blot: Aldo-keto Reductase 1B10/AKR1B10 Antibody [NBP1-89161]

Western Blot: Aldo-keto Reductase 1B10/AKR1B10 Antibody [NBP1-89161]

Western Blot: Aldo-keto Reductase 1B10/AKR1B10 Antibody [NBP1-89161] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-28
Aldo-keto Reductase 1B10/AKR1B10 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: Aldo-keto Reductase 1B10/AKR1B10 Antibody [NBP1-89161]

Immunocytochemistry/ Immunofluorescence: Aldo-keto Reductase 1B10/AKR1B10 Antibody [NBP1-89161]

Staining of human cell line A549 shows localization to plasma membrane & cytosol.

Applications for Aldo-keto Reductase 1B10/AKR1B10 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Aldo-keto Reductase 1B10/AKR1B10

AKR1B10 encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis.

Long Name

Aldo-keto Reductase Family 1, Member B10 [Aldose Reductase]

Alternate Names

AKR1B10, AKR1B11, AKR1B12, AldoketoReductase 1B10, ARL1, HIS, HSI

Gene Symbol

AKR1B10

Additional Aldo-keto Reductase 1B10/AKR1B10 Products

Product Documents for Aldo-keto Reductase 1B10/AKR1B10 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Aldo-keto Reductase 1B10/AKR1B10 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Aldo-keto Reductase 1B10/AKR1B10 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Aldo-keto Reductase 1B10/AKR1B10 Antibody - BSA Free and earn rewards!

Have you used Aldo-keto Reductase 1B10/AKR1B10 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies