alpha-Methylacyl-CoA Racemase/AMACR Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87169

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: HNKERGSFITSEEQDVSPRPAPLLLNTPAIPSFKRDPFIGEHTEEILEEFGFSREEIYQLNSDKIIESNKVKASL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for alpha-Methylacyl-CoA Racemase/AMACR Antibody - BSA Free

Western Blot: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87169]

Western Blot: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87169]

Western Blot: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87169] - Analysis using Anti-AMACR antibody NBP1-87169 (A) shows similar pattern to independent antibody NBP1-87168 (B).
Immunohistochemistry-Paraffin: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87169]

Immunohistochemistry-Paraffin: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87169]

Immunohistochemistry-Paraffin: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87169] - Staining of human pancreas using Anti-AMACR antibody NBP1-87169.
Western Blot: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87169]

Western Blot: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87169]

Western Blot: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87169] - Analysis in human cell lines Caco-2 and U2OS. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Immunohistochemistry-Paraffin: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87169]

Immunohistochemistry-Paraffin: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87169]

Immunohistochemistry-Paraffin: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87169] - Staining in human kidney and pancreas tissues using anti-AMACR antibody. Corresponding AMACR RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87169]

Immunohistochemistry-Paraffin: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87169]

Immunohistochemistry-Paraffin: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87169] - Staining of human kidney, liver, lymph node and pancreas using Anti-AMACR antibody NBP1-87169 (A) shows similar protein distribution across tissues to independent antibody NBP1-87168 (B).
Immunohistochemistry-Paraffin: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87169]

Immunohistochemistry-Paraffin: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87169]

Immunohistochemistry-Paraffin: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87169] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87169]

Immunohistochemistry-Paraffin: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87169]

Immunohistochemistry-Paraffin: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87169] - Staining of human liver.
Immunohistochemistry-Paraffin: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87169]

Immunohistochemistry-Paraffin: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87169]

Immunohistochemistry-Paraffin: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87169] - Staining of human lymph node.
Immunohistochemistry-Paraffin: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87169]

Immunohistochemistry-Paraffin: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87169]

Immunohistochemistry-Paraffin: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87169] - Staining of human kidney using Anti-AMACR antibody NBP1-87169.

Applications for alpha-Methylacyl-CoA Racemase/AMACR Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: alpha-Methylacyl-CoA Racemase/AMACR

AMACR (alpha-methylacyl-CoA racemase) has been recently described as prostate cancer-specific gene that encodes a protein involved in the beta-oxidation of branched chain fatty acids. Expression of AMACR protein is found in prostatic adenocarcinoma but not in benign prostatic tissue. It stains premalignant lesions of prostate: high-grade prostatic intraepithelial neoplasia (PIN) and atypical adenomatous hyperplasia. AMACR can be used as a positive marker for PIN. Defects in AMACR are the cause of congenital bile acid synthesis defect type 4 (CBAS4); also known as cholestasis, intrahepatic, with defective conversion of trihydroxycoprostanic acid to cholic acid or trihydroxycoprostanic acid in bile. Clinical features include neonatal jaundice, intrahepatic cholestasis, bile duct deficiency and absence of cholic acid from bile.

Alternate Names

alphaMethylacylCoARacemase, AMACR, AMACRD, CBAS4, RACE

Gene Symbol

AMACR

Additional alpha-Methylacyl-CoA Racemase/AMACR Products

Product Documents for alpha-Methylacyl-CoA Racemase/AMACR Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for alpha-Methylacyl-CoA Racemase/AMACR Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for alpha-Methylacyl-CoA Racemase/AMACR Antibody - BSA Free

There are currently no reviews for this product. Be the first to review alpha-Methylacyl-CoA Racemase/AMACR Antibody - BSA Free and earn rewards!

Have you used alpha-Methylacyl-CoA Racemase/AMACR Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...