alpha-Taxilin Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91662

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: RNDLNKRVQDLSAGGQGSLTDSGPERRPEGPGAQAPSSPRVTEAPCYPGAPSTE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for alpha-Taxilin Antibody - BSA Free

Immunohistochemistry-Paraffin: alpha-Taxilin Antibody [NBP1-91662]

Immunohistochemistry-Paraffin: alpha-Taxilin Antibody [NBP1-91662]

Immunohistochemistry-Paraffin: alpha-Taxilin Antibody [NBP1-91662] - Analysis in human testis and heart muscle tissues. Corresponding TXLNA RNA-seq data are presented for the same tissues.
Western Blot: alpha-Taxilin Antibody [NBP1-91662]

Western Blot: alpha-Taxilin Antibody [NBP1-91662]

Western Blot: alpha-Taxilin Antibody [NBP1-91662] - Analysis in human cell line HELA.
Immunohistochemistry-Paraffin: alpha-Taxilin Antibody [NBP1-91662]

Immunohistochemistry-Paraffin: alpha-Taxilin Antibody [NBP1-91662]

Immunohistochemistry-Paraffin: alpha-Taxilin Antibody [NBP1-91662] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: alpha-Taxilin Antibody [NBP1-91662]

Immunohistochemistry-Paraffin: alpha-Taxilin Antibody [NBP1-91662]

Immunohistochemistry-Paraffin: alpha-Taxilin Antibody [NBP1-91662] - Staining of human Fallopian tube shows moderate cytoplasmic/membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: alpha-Taxilin Antibody [NBP1-91662]

Immunohistochemistry-Paraffin: alpha-Taxilin Antibody [NBP1-91662]

Immunohistochemistry-Paraffin: alpha-Taxilin Antibody [NBP1-91662] - Staining of human heart muscle shows no positivity in cardiomyocytes as expected.
Immunohistochemistry-Paraffin: alpha-Taxilin Antibody [NBP1-91662]

Immunohistochemistry-Paraffin: alpha-Taxilin Antibody [NBP1-91662]

Immunohistochemistry-Paraffin: alpha-Taxilin Antibody [NBP1-91662] - Staining of human skeletal muscle shows low cytoplasmic positivity in myocytes as expected.
Immunohistochemistry-Paraffin: alpha-Taxilin Antibody [NBP1-91662]

Immunohistochemistry-Paraffin: alpha-Taxilin Antibody [NBP1-91662]

Immunohistochemistry-Paraffin: alpha-Taxilin Antibody [NBP1-91662] - Staining of human skin shows weak to moderate cytoplasmic positivity in squamous epithelial cells.
alpha-Taxilin Antibody - BSA Free Western Blot: alpha-Taxilin Antibody - BSA Free [NBP1-91662]

Western Blot: alpha-Taxilin Antibody - BSA Free [NBP1-91662]

Analysis in human cell line HEL.
alpha-Taxilin Antibody - BSA Free Immunohistochemistry: alpha-Taxilin Antibody - BSA Free [NBP1-91662]

Immunohistochemistry: alpha-Taxilin Antibody - BSA Free [NBP1-91662]

Analysis in human testis and heart muscle tissues using NBP1-91662 antibody. Corresponding TXLNA RNA-seq data are presented for the same tissues.
alpha-Taxilin Antibody - BSA Free Immunohistochemistry: alpha-Taxilin Antibody - BSA Free [NBP1-91662]

Immunohistochemistry: alpha-Taxilin Antibody - BSA Free [NBP1-91662]

Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
alpha-Taxilin Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: alpha-Taxilin Antibody - BSA Free [NBP1-91662]

Immunocytochemistry/ Immunofluorescence: alpha-Taxilin Antibody - BSA Free [NBP1-91662]

Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.

Applications for alpha-Taxilin Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: alpha-Taxilin

Alpha Taxilin may be involved in intracellular vesicle traffic and potentially in calcium-dependent exocytosis inneuroendocrine cells

Alternate Names

alphaTaxilin, IL-14, TXLNA

Entrez Gene IDs

200081 (Human)

Gene Symbol

TXLNA

UniProt

Additional alpha-Taxilin Products

Product Documents for alpha-Taxilin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for alpha-Taxilin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for alpha-Taxilin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review alpha-Taxilin Antibody - BSA Free and earn rewards!

Have you used alpha-Taxilin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for alpha-Taxilin Antibody - BSA Free

Showing  1 - 11 FAQ Showing All
  • Q: I was wondering if I can order alpha-Taxilin antibody (NBP1-91662) with no glycerol in it?

    A: Unfortunately, NBP1-91662 is not available in a glycerol free format.

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies
Loading...