Amphiphysin/AMPH Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-86033

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (99%), Rat (99%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: PGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQDAGWLVGVKESDWLQYRDLATYKGLFPENFTRRL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Amphiphysin/AMPH Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Amphiphysin/AMPH Antibody [NBP1-86033]

Immunocytochemistry/ Immunofluorescence: Amphiphysin/AMPH Antibody [NBP1-86033]

Immunocytochemistry/Immunofluorescence: Amphiphysin/AMPH Antibody [NBP1-86033] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Amphiphysin/AMPH Antibody - BSA Free Immunohistochemistry-Paraffin: Amphiphysin/AMPH Antibody - BSA Free [NBP1-86033]

Immunohistochemistry-Paraffin: Amphiphysin/AMPH Antibody - BSA Free [NBP1-86033]

Staining of human colon shows strong cytoplasmic positivity in peripheral nerve / ganglion.
Amphiphysin/AMPH Antibody - BSA Free Immunohistochemistry-Paraffin: Amphiphysin/AMPH Antibody - BSA Free [NBP1-86033]

Immunohistochemistry-Paraffin: Amphiphysin/AMPH Antibody - BSA Free [NBP1-86033]

Staining of human placenta shows no positivity in trophoblastic cells as expected.
Amphiphysin/AMPH Antibody - BSA Free Immunohistochemistry-Paraffin: Amphiphysin/AMPH Antibody - BSA Free [NBP1-86033]

Immunohistochemistry-Paraffin: Amphiphysin/AMPH Antibody - BSA Free [NBP1-86033]

Staining of human tonsil shows no positivity in non-germinal center cells as expected.
Amphiphysin/AMPH Antibody - BSA Free Immunohistochemistry-Paraffin: Amphiphysin/AMPH Antibody - BSA Free [NBP1-86033]

Immunohistochemistry-Paraffin: Amphiphysin/AMPH Antibody - BSA Free [NBP1-86033]

Staining of human cerebral cortex, colon, placenta and tonsil using Anti-AMPH antibody NBP1-86033 (A) shows similar protein distribution across tissues to independent antibody NBP1-87561 (B).
Amphiphysin/AMPH Antibody - BSA Free Western Blot: Amphiphysin/AMPH Antibody - BSA Free [NBP1-86033]

Western Blot: Amphiphysin/AMPH Antibody - BSA Free [NBP1-86033]

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Amphiphysin/AMPH Antibody - BSA Free Immunohistochemistry-Paraffin: Amphiphysin/AMPH Antibody - BSA Free [NBP1-86033]

Immunohistochemistry-Paraffin: Amphiphysin/AMPH Antibody - BSA Free [NBP1-86033]

Staining of human cerebral cortex, colon, placenta and tonsil HPA019829 (A) shows similar protein distribution across tissues to independent antibody HPA019828 (B).

Applications for Amphiphysin/AMPH Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Amphiphysin/AMPH

Amphiphysin, a neuronal protein first identified in chicken synaptic membranes, is the autoantigen of Stiff-Man Syndrome (SMS) associated with breast cancer. Patient autoantibodies have a distinct pattern of reactivity with amphiphysin, and the dominant autoepitope is located in its C-terminal region, which contains an SH3 domain (1). Amphiphysin is expressed in many neurons, certain endocrine cell types, and spermatocytes (2). study suggests a link between amphiphysin I expression in cancer and amphiphysin I autoimmunity. The enhanced expression of amphiphysin I in some forms of cancer supports the hypothesis that amphiphysin family members may play a role in the biology of cancer cells (3).

Alternate Names

AMPH, AMPH1

Gene Symbol

AMPH

Additional Amphiphysin/AMPH Products

Product Documents for Amphiphysin/AMPH Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Amphiphysin/AMPH Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Amphiphysin/AMPH Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Amphiphysin/AMPH Antibody - BSA Free and earn rewards!

Have you used Amphiphysin/AMPH Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...