AMPK alpha 2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38532

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (94%), Rat (94%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all AMPK alpha 2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: IDDEVVEQRSGSSTPQRSCSAAGLHRPRSSFDSTTAESHSLSGSLTGSLTGSTLSSVSPRLGSHTMDFFEMCASLITTLAR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit AMPK alpha 2 Antibody - BSA Free (NBP2-38532) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for AMPK alpha 2 Antibody - BSA Free

Western Blot: AMPK alpha 2 Antibody [NBP2-38532]

Western Blot: AMPK alpha 2 Antibody [NBP2-38532]

Western Blot: AMPK alpha 2 Antibody [NBP2-38532] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
Immunocytochemistry/ Immunofluorescence: AMPK alpha 2 Antibody [NBP2-38532]

Immunocytochemistry/ Immunofluorescence: AMPK alpha 2 Antibody [NBP2-38532]

Immunocytochemistry/Immunofluorescence: AMPK alpha 2 Antibody [NBP2-38532] - Staining of human cell line HEK 293 shows localization to nuclear speckles & the Golgi apparatus.
Immunohistochemistry-Paraffin: AMPK alpha 2 Antibody [NBP2-38532]

Immunohistochemistry-Paraffin: AMPK alpha 2 Antibody [NBP2-38532]

Immunohistochemistry-Paraffin: AMPK alpha 2 Antibody [NBP2-38532] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuropil.
Immunohistochemistry-Paraffin: AMPK alpha 2 Antibody [NBP2-38532]

Immunohistochemistry-Paraffin: AMPK alpha 2 Antibody [NBP2-38532]

Immunohistochemistry-Paraffin: AMPK alpha 2 Antibody [NBP2-38532] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: AMPK alpha 2 Antibody [NBP2-38532]

Immunohistochemistry-Paraffin: AMPK alpha 2 Antibody [NBP2-38532]

Immunohistochemistry-Paraffin: AMPK alpha 2 Antibody [NBP2-38532] - Staining of human cerebellum shows strong cytoplasmic positivity in cells in granular layer.
Immunohistochemistry-Paraffin: AMPK alpha 2 Antibody [NBP2-38532]

Immunohistochemistry-Paraffin: AMPK alpha 2 Antibody [NBP2-38532]

Immunohistochemistry-Paraffin: AMPK alpha 2 Antibody [NBP2-38532] - Staining of human liver shows no positivity in hepatocytes as expected.

Applications for AMPK alpha 2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: AMPK alpha 2

Protein kinases are enzymes that transfer a phosphate group from a phosphate donor, generally the g phosphate of ATP, onto an acceptor amino acid in a substrate protein. By this basic mechanism, protein kinases mediate most of the signal transduction in eukaryotic cells, regulating cellular metabolism, transcription, cell cycle progression, cytoskeletal rearrangement and cell movement, apoptosis, and differentiation. With more than 500 gene products, the protein kinase family is one of the largest families of proteins in eukaryotes. The family has been classified in 8 major groups based on sequence comparison of their tyrosine (PTK) or serine/threonine (STK) kinase catalytic domains.

Long Name

AMP-activated Protein Kinase alpha

Alternate Names

PRKAA2

Gene Symbol

PRKAA2

UniProt

P54646

Additional AMPK alpha 2 Products

Product Documents for AMPK alpha 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for AMPK alpha 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Autophagy
Intracellular Kinases
Obesity

Customer Reviews for AMPK alpha 2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review AMPK alpha 2 Antibody - BSA Free and earn rewards!

Have you used AMPK alpha 2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies