Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7)

Novus Biologicals | Catalog # NBP3-16596

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 4W9A7 expressed in HEK293
View all Angiopoietin-like Protein 3/ANGPTL3 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Angiopoietin-like Protein 3/ANGPTL3 (Q9Y5C1). MFTIKLLLFIVPLVISSRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELR

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7)

Immunohistochemistry-Paraffin: Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7) [NBP3-16596]

Immunohistochemistry-Paraffin: Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7) [NBP3-16596]

Immunohistochemistry-Paraffin: Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7) [NBP3-16596] - Immunohistochemistry of paraffin-embedded mouse kidney using Angiopoietin-like Protein 3/ANGPTL3 Rabbit mAb (NBP3-16596) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7)

Immunohistochemistry-Paraffin: Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7) [NBP3-16596] -

Immunohistochemistry-Paraffin: Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7) [NBP3-16596] - Confocal imaging of paraffin-embedded Rat liver using ANGPTL3 Rabbit mAb (dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7)

Immunohistochemistry-Paraffin: Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7) [NBP3-16596] -

Immunohistochemistry-Paraffin: Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7) [NBP3-16596] - Confocal imaging of paraffin-embedded Mouse liver using ANGPTL3 Rabbit mAb (dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7)

Western Blot: Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7) [Angiopoietin-like Protein 3/ANGPTL3] -

Western Blot: Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7) [Angiopoietin-like Protein 3/ANGPTL3] - Western blot analysis of various lysates using Angiopoietin-like Protein 3/ANGPTL3 Rabbit mAb at 1:1000 dilution incubated at room temperature for 1.5 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.

Applications for Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Immunocytochemistry/ Immunofluorescence

1:200 - 1:800

Immunohistochemistry

1:100 - 1:1000

Immunohistochemistry-Paraffin

1:100 - 1:1000

Western Blot

1:1000 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Angiopoietin-like Protein 3/ANGPTL3

ANGPTL3 is a 460 amino acid protein that is found most commonly in the liver, but has also been shown to reside in kidney samples, and contains three domains consisting of a signal peptide, N-terminal coiled-coil and C-terminal Fibrinogen (FBN) like domain. This protein is involved with the lipid metabolism disease pathways in relation to low levels of LDL (low density lipoproteins), HDL (High density lipoproteins), and triglycerides in plasma. This protein plays a role in angiogenesis and has been shown to interact with ITGAV, ITGB3, and ITGA5, and work is being done to study the protein and the related hypobetalipoproteinemia and atherosclerosis involvement.

Alternate Names

AGNPT5, Ang-5, Angiopoietin-5, ANGPTL3

Gene Symbol

ANGPTL3

Additional Angiopoietin-like Protein 3/ANGPTL3 Products

Product Documents for Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7)

There are currently no reviews for this product. Be the first to review Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7) and earn rewards!

Have you used Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies