Annexin A13 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-90158

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: RHSQSYTLSEGSQQLPKGDSQPSTVVQPLSHPSRNGEPEAPQPAKASSPQGFDVDRDAKKLNKACKGMGTN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Annexin A13 Antibody - BSA Free

Immunohistochemistry-Paraffin: Annexin A13 Antibody [NBP1-90158]

Immunohistochemistry-Paraffin: Annexin A13 Antibody [NBP1-90158]

Immunohistochemistry-Paraffin: Annexin A13 Antibody [NBP1-90158] - Staining of human duodenum, fallopian tube, gallbladder and small intestine using Anti-ANXA13 antibody NBP1-90158 (A) shows similar protein distribution across tissues to independent antibody NBP1-90159 (B).
Immunohistochemistry-Paraffin: Annexin A13 Antibody [NBP1-90158]

Immunohistochemistry-Paraffin: Annexin A13 Antibody [NBP1-90158]

Immunohistochemistry-Paraffin: Annexin A13 Antibody [NBP1-90158] - Staining in human duodenum and pancreas tissues using anti-ANXA13 antibody. Corresponding ANXA13 RNA-seq data are presented for the same tissues.
Annexin A13 Antibody - BSA Free Immunohistochemistry: Annexin A13 Antibody - BSA Free [NBP1-90158]

Immunohistochemistry: Annexin A13 Antibody - BSA Free [NBP1-90158]

Staining of human duodenum shows high expression.
Annexin A13 Antibody - BSA Free Immunohistochemistry: Annexin A13 Antibody - BSA Free [NBP1-90158]

Immunohistochemistry: Annexin A13 Antibody - BSA Free [NBP1-90158]

Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Annexin A13 Antibody [NBP1-90158]

Immunohistochemistry-Paraffin: Annexin A13 Antibody [NBP1-90158]

Immunohistochemistry-Paraffin: Annexin A13 Antibody [NBP1-90158] - Staining of human fallopian tube.
Immunohistochemistry-Paraffin: Annexin A13 Antibody [NBP1-90158]

Immunohistochemistry-Paraffin: Annexin A13 Antibody [NBP1-90158]

Immunohistochemistry-Paraffin: Annexin A13 Antibody [NBP1-90158] - Staining of human small intestine.
Immunohistochemistry-Paraffin: Annexin A13 Antibody [NBP1-90158]

Immunohistochemistry-Paraffin: Annexin A13 Antibody [NBP1-90158]

Immunohistochemistry-Paraffin: Annexin A13 Antibody [NBP1-90158] - Staining of human gallbladder.
Immunohistochemistry-Paraffin: Annexin A13 Antibody [NBP1-90158]

Immunohistochemistry-Paraffin: Annexin A13 Antibody [NBP1-90158]

Immunohistochemistry-Paraffin: Annexin A13 Antibody [NBP1-90158] - Staining of human duodenum using Anti-ANXA13 antibody NBP1-90158.
Western Blot: Annexin A13 Antibody [NBP1-90158]

Western Blot: Annexin A13 Antibody [NBP1-90158]

Western Blot: Annexin A13 Antibody [NBP1-90158] - Analysis using Anti-ANXA13 antibody NBP1-90158 (A) shows similar pattern to independent antibody NBP1-90157 (B).

Applications for Annexin A13 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Annexin A13

Annexin A13 encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. The specific function of this gene has not yet been determined; however, it is associated with the plasma membrane of undifferentiated, proliferating endothelial cells and differentiated villus enterocytes. Alternatively spliced transcript variants encoding different isoforms have been identified.

Alternate Names

ANX13, ANXA13, ISA

Gene Symbol

ANXA13

Additional Annexin A13 Products

Product Documents for Annexin A13 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Annexin A13 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Annexin A13 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Annexin A13 Antibody - BSA Free and earn rewards!

Have you used Annexin A13 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...