ANP32A Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38183

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human ANP32A (NP_006296.1).

Sequence:
MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ANP32A Antibody - BSA Free

ANP32A Antibody

Western Blot: ANP32A Antibody [NBP3-38183] -

Western Blot: ANP32A Antibody [NBP3-38183] - Western blot analysis of various lysates, using ANP32A Rabbit pAb at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
ANP32A Antibody

Immunohistochemistry: ANP32A Antibody [NBP3-38183] -

Immunohistochemistry: ANP32A Antibody [NBP3-38183] - Immunohistochemistry analysis of paraffin-embedded Human breast cancer using ANP32A Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
ANP32A Antibody

Immunohistochemistry: ANP32A Antibody [NBP3-38183] -

Immunohistochemistry: ANP32A Antibody [NBP3-38183] - Immunohistochemistry analysis of paraffin-embedded Mouse brain using ANP32A Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
ANP32A Antibody

Immunohistochemistry: ANP32A Antibody [NBP3-38183] -

Immunohistochemistry: ANP32A Antibody [NBP3-38183] - Immunohistochemistry analysis of paraffin-embedded Rat kidney using ANP32A Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Applications for ANP32A Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ANP32A

Implicated in a number of cellular processes, including proliferation, differentiation, caspase-dependent and caspase-independent apoptosis, suppression of transformation (tumor suppressor), inhibition of protein phosphatase 2A, regulation of mRNA trafficking and stability in association with ELAVL1, and inhibition of acetyltransferases as part of the INHAT (inhibitor of histone acetyltransferases) complex. Plays a role in E4F1-mediated transcriptional repression

Alternate Names

acidic (leucine-rich) nuclear phosphoprotein 32 family, member A, acidic leucine-rich nuclear phosphoprotein 32 family member A, Acidic nuclear phosphoprotein pp32, cerebellar leucine rich acidic nuclear protein, I1PP2A, inhibitor-1 of protein phosphatase-2A, LANPPutative HLA-DR-associated protein I, Leucine-rich acidic nuclear protein, MAPMC15orf1, mapmodulin, PHAP1MGC150373, PHAPIMGC119787, Potent heat-stable protein phosphatase 2A inhibitor I1PP2A, PP32, putative human HLA class II associated protein I

Gene Symbol

ANP32A

Additional ANP32A Products

Product Documents for ANP32A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ANP32A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ANP32A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ANP32A Antibody - BSA Free and earn rewards!

Have you used ANP32A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...