Aquaporin-3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33872

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (94%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: QLMIGCHLEQPPPSNEEENVKLAHVKHKEQI

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (87%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Aquaporin-3 Antibody - BSA Free

Immunohistochemistry-Paraffin: Aquaporin-3 Antibody [NBP2-33872]

Immunohistochemistry-Paraffin: Aquaporin-3 Antibody [NBP2-33872]

Immunohistochemistry-Paraffin: Aquaporin-3 Antibody [NBP2-33872] - Staining in human esophagus and skeletal muscle tissues. Corresponding AQP3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Aquaporin-3 Antibody [NBP2-33872]

Immunohistochemistry-Paraffin: Aquaporin-3 Antibody [NBP2-33872]

Immunohistochemistry-Paraffin: Aquaporin-3 Antibody [NBP2-33872] - Staining of human esophagus shows membranous positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: Aquaporin-3 Antibody [NBP2-33872]

Immunohistochemistry-Paraffin: Aquaporin-3 Antibody [NBP2-33872]

Immunohistochemistry-Paraffin: Aquaporin-3 Antibody [NBP2-33872] - Staining of human kidney shows membranous positivity in cells in distal tubules.
Immunohistochemistry-Paraffin: Aquaporin-3 Antibody [NBP2-33872]

Immunohistochemistry-Paraffin: Aquaporin-3 Antibody [NBP2-33872]

Immunohistochemistry-Paraffin: Aquaporin-3 Antibody [NBP2-33872] - Staining of human prostate shows membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: Aquaporin-3 Antibody [NBP2-33872]

Immunohistochemistry-Paraffin: Aquaporin-3 Antibody [NBP2-33872]

Immunohistochemistry-Paraffin: Aquaporin-3 Antibody [NBP2-33872] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Aquaporin-3 Antibody [NBP2-33872]

Immunohistochemistry-Paraffin: Aquaporin-3 Antibody [NBP2-33872]

Immunohistochemistry-Paraffin: Aquaporin-3 Antibody [NBP2-33872] - Staining of human skin shows membranous positivity in epidermal cells.
Aquaporin-3 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: Aquaporin-3 Antibody [NBP2-33872]

Immunocytochemistry/ Immunofluorescence: Aquaporin-3 Antibody [NBP2-33872]

Staining of human cell line RT4 shows localization to plasma membrane.

Applications for Aquaporin-3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Aquaporin-3

Aquaporin 3 is a water channel protein. Aquaporins are a family of small integral membrane proteins related to themajor intrinsic protein (MIP or AQP0). Aquaporin 3 is localized at the basal lateral membranes of collecting ductcells in the kidney. In addition to its water channel function, aquaporin 3 has been found to facilitate the transportof nonionic small solutes such as urea and glycerol, but to a smaller degree. It has been suggested that waterchannels can be functionally heterogeneous and possess water and solute permeation mechanisms. (provided by RefSeq)

Alternate Names

AQP-3, aquaglyceroporin-3, aquaporin 3, aquaporin 3 (GIL blood group), aquaporin 3 (Gill blood group), aquaporin-3, GIL, Gill blood group

Gene Symbol

AQP3

UniProt

Additional Aquaporin-3 Products

Product Documents for Aquaporin-3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Aquaporin-3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Aquaporin-3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Aquaporin-3 Antibody - BSA Free and earn rewards!

Have you used Aquaporin-3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Aquaporin-3 Antibody - BSA Free

Showing  1 - 11 FAQ Showing All
  • Q: I am from China and I would like to know more about your product number:NBL1-07638. We know that the theoretical MW of AQP3 protein is 31KD. But in your product specification, we can see that so many bands appear after overexpressing AQP3 with plasmid in 293 cell. Can you explain this phenomenon? Apart from theoretical strip, are all other nonspecific bands? Or is the AQP3 itself ? 

    A: Yes, the theoretical size of AQP3 is 31 kDa, which would be expected under reduced conditions with a sample. We have not characterized any of the other bands in the overexpressed lysate lane. Because this is a native lysate, any modifications that may take place could cause smearing and extra bands in the lysate sample. AQP3 is extensively modified because it is a glycoprotein, glycosylation often shows up as multiple bands with smearing when run under native conditions.  This overexpression lysate is meant to only act as a positive control in WB experiments requiring a native control. Furthermore, the lane on the right side of the blot is showing detection of the lysate using an anti-Flag tag antibody, since the construct used for overexpression contains a Flag tag. 

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies
Loading...