Aquaporin-6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-90119

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: PDTKTLAQRLAILTGTVEVGTGAGAGAEPLKKESQPGSGAVEME

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Aquaporin-6 Antibody - BSA Free

Aquaporin-6 Antibody - BSA Free Immunohistochemistry: Aquaporin-6 Antibody - BSA Free [NBP1-90119]

Immunohistochemistry: Aquaporin-6 Antibody - BSA Free [NBP1-90119]

Analysis in human kidney and pancreas tissues using NBP1-90119 antibody. Corresponding AQP6 RNA-seq data are presented for the same tissues.
Aquaporin-6 Antibody - BSA Free Immunohistochemistry: Aquaporin-6 Antibody - BSA Free [NBP1-90119]

Immunohistochemistry: Aquaporin-6 Antibody - BSA Free [NBP1-90119]

Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: Aquaporin-6 Antibody [NBP1-90119]

Immunohistochemistry-Paraffin: Aquaporin-6 Antibody [NBP1-90119]

Immunohistochemistry-Paraffin: Aquaporin-6 Antibody [NBP1-90119] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: Aquaporin-6 Antibody [NBP1-90119]

Immunohistochemistry-Paraffin: Aquaporin-6 Antibody [NBP1-90119]

Immunohistochemistry-Paraffin: Aquaporin-6 Antibody [NBP1-90119] - Staining of human stomach shows moderate to strong cytoplasmic positivity in a subset of glandular cells.
Aquaporin-6 Antibody - BSA Free Immunohistochemistry: Aquaporin-6 Antibody - BSA Free [NBP1-90119]

Immunohistochemistry: Aquaporin-6 Antibody - BSA Free [NBP1-90119]

Staining of human tonsil shows no positivity in germinal center cells as expected.
Immunohistochemistry-Paraffin: Aquaporin-6 Antibody [NBP1-90119]

Immunohistochemistry-Paraffin: Aquaporin-6 Antibody [NBP1-90119]

Immunohistochemistry-Paraffin: Aquaporin-6 Antibody [NBP1-90119] - Human kidney tissue. Heat mediated antigen retrieval was performed by heating in citrate buffer (pH6) at 95C for 20 minutes. Image from verified customer review.

Applications for Aquaporin-6 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Aquaporin-6 antibody validated for IHC-P from a verified customer review.

Reviewed Applications

Read 1 review rated 4 using NBP1-90119 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Aquaporin-6

The protein encoded by the Aquaporin 6 Aquaporin 6 gene is an aquaporin protein, which functions as a water channel in cells. Aquaporins are a family of small integral membrane proteins related to the major intrinsic protein (MIP or AQP0). This protein is specific for the kidney. This gene and related family members AQP0, AQP2, and AQP5 reside in a cluster on chromosome 12q13. (provided by RefSeq)

Alternate Names

AQP2L, aquaporin 2-like, kidney specific, aquaporin 6, kidney specific, hKID, kidney specific

Gene Symbol

AQP6

Additional Aquaporin-6 Products

Product Documents for Aquaporin-6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Aquaporin-6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Aquaporin-6 Antibody - BSA Free (1)

4 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used Aquaporin-6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 1 的 1 review Showing All
Filter By:
  • Aquaporin-6 Antibody
    Name: Santhosh Sivajothi
    Application: Immunohistochemistry-Paraffin
    Sample Tested: Human kidney tissue
    Species: Human
    Verified Customer | Posted 05/22/2018
    Heat mediated antigen retrieval was performed by heating in citrate buffer (pH6) at 95C for 20 minutes
    Aquaporin-6 Antibody - BSA Free NBP1-90119

There are no reviews that match your criteria.

Showing  1 - 1 的 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...