Argininosuccinate Synthase Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88868

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (95%), Rat (97%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: AKQHGIPIPVTPKNPWSMDENLMHISYEAGILENPKNQAPPGLYTKTQDPAKAPNTPDILEIEFKKGVPVKVTNVKDG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Argininosuccinate Synthase Antibody - BSA Free

Western Blot: Argininosuccinate Synthase Antibody [NBP1-88868]

Western Blot: Argininosuccinate Synthase Antibody [NBP1-88868]

Western Blot: Argininosuccinate Synthase Antibody [NBP1-88868] - ASS1 was successfully silenced in H4-II-E-C3 cells. Image from verified customer review.
Immunocytochemistry/ Immunofluorescence: Argininosuccinate Synthase Antibody [NBP1-88868]

Immunocytochemistry/ Immunofluorescence: Argininosuccinate Synthase Antibody [NBP1-88868]

Immunocytochemistry/Immunofluorescence: Argininosuccinate Synthase Antibody [NBP1-88868] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868]

Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868]

Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868] - Staining of human skin shows moderate cytoplasmic positivity in a subset of squamous epithelial cells.
Western Blot: Argininosuccinate Synthase Antibody [NBP1-88868]

Western Blot: Argininosuccinate Synthase Antibody [NBP1-88868]

Western Blot: Argininosuccinate Synthase Antibody [NBP1-88868] - Analysis in human cell lines MCF-7 and U-251MG using anti-ASS1 antibody. Corresponding ASS1 RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868]

Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868]

Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868]

Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868]

Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868] - Analysis in human kidney and lymph node tissues using NBP1-88868 antibody. Corresponding ASS1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868]

Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868]

Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868] - Staining of human kidney, liver, lymph node and skin using Anti-ASS1 antibody NBP1-88868 (A) shows similar protein distribution across tissues to independent antibody NBP1-88867 (B).
Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868]

Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868]

Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868]

Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868]

Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868] - Staining of human lymph node shows no cytoplasmic positivity in germinal center cells as expected.
Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868]

Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868]

Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.

Applications for Argininosuccinate Synthase Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 µg/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Reviewed Applications

Read 1 review rated 4 using NBP1-88868 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Argininosuccinate Synthase

Argininosuccinate Synthase is encoded by this gene catalyzes the penultimate step of the arginine biosynthetic pathway. There are approximately 10 to 14 copies of this gene including the pseudogenes scattered across the human genome, among which the one located on chromosome 9 appears to be the only functional gene for argininosuccinate synthetase. Mutations in the chromosome 9 copy of Argininosuccinate Synthase cause citrullinemia. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Alternate Names

argininosuccinate synthase, argininosuccinate synthase 1, argininosuccinate synthetase, argininosuccinate synthetase 1, ASSCTLN1, citrulline-aspartate ligase, Citrulline--aspartate ligase, EC 6.3.4.5

Gene Symbol

ASS1

Additional Argininosuccinate Synthase Products

Product Documents for Argininosuccinate Synthase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Argininosuccinate Synthase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Argininosuccinate Synthase Antibody - BSA Free (1)

4 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used Argininosuccinate Synthase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 11 review Showing All
Filter By:
  • Argininosuccinate Synthase Antibody
    Name: Anonymous
    Application: Western Blot
    Sample Tested: H4-II-E-C3 rat hepatoma cell line
    Species: Rat
    Verified Customer | Posted 03/08/2018
    ASS1 was successfully silenced in H4-II-E-C3 cells.
    Argininosuccinate Synthase Antibody - BSA Free NBP1-88868

There are no reviews that match your criteria.

Showing  1 - 11 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...