ARHGAP25 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57228

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (90%), Rat (90%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LYYYKDEEDTKPQGCMYLPGCTIKEIATNPEEAGKFVFEIIPASWDQNRMGQDSYVLMASSQAEMEEWVKFLRRVAGTPC

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ARHGAP25 Antibody - BSA Free

Western Blot: ARHGAP25 Antibody [NBP2-57228]

Western Blot: ARHGAP25 Antibody [NBP2-57228]

Western Blot: ARHGAP25 Antibody [NBP2-57228] - Analysis using Anti-ARHGAP25 antibody NBP2-57228 (A) shows similar pattern to independent antibody NBP1-83053 (B).
Immunocytochemistry/ Immunofluorescence: ARHGAP25 Antibody [NBP2-57228]

Immunocytochemistry/ Immunofluorescence: ARHGAP25 Antibody [NBP2-57228]

Immunocytochemistry/Immunofluorescence: ARHGAP25 Antibody [NBP2-57228] - Staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.
Immunohistochemistry-Paraffin: ARHGAP25 Antibody [NBP2-57228]

Immunohistochemistry-Paraffin: ARHGAP25 Antibody [NBP2-57228]

Immunohistochemistry-Paraffin: ARHGAP25 Antibody [NBP2-57228] - Staining of human kidney.
Western Blot: ARHGAP25 Antibody [NBP2-57228]

Western Blot: ARHGAP25 Antibody [NBP2-57228]

Western Blot: ARHGAP25 Antibody [NBP2-57228] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunohistochemistry-Paraffin: ARHGAP25 Antibody [NBP2-57228]

Immunohistochemistry-Paraffin: ARHGAP25 Antibody [NBP2-57228]

Immunohistochemistry-Paraffin: ARHGAP25 Antibody [NBP2-57228] - Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: ARHGAP25 Antibody [NBP2-57228]

Immunohistochemistry-Paraffin: ARHGAP25 Antibody [NBP2-57228]

Immunohistochemistry-Paraffin: ARHGAP25 Antibody [NBP2-57228] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: ARHGAP25 Antibody [NBP2-57228]

Immunohistochemistry-Paraffin: ARHGAP25 Antibody [NBP2-57228]

Immunohistochemistry-Paraffin: ARHGAP25 Antibody [NBP2-57228] - Staining of human spleen shows high expression.
Immunohistochemistry-Paraffin: ARHGAP25 Antibody [NBP2-57228]

Immunohistochemistry-Paraffin: ARHGAP25 Antibody [NBP2-57228]

Immunohistochemistry-Paraffin: ARHGAP25 Antibody [NBP2-57228] - Staining in human spleen and cerebral cortex tissues using anti-ARHGAP25 antibody. Corresponding ARHGAP25 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ARHGAP25 Antibody [NBP2-57228]

Immunohistochemistry-Paraffin: ARHGAP25 Antibody [NBP2-57228]

Immunohistochemistry-Paraffin: ARHGAP25 Antibody [NBP2-57228] - Staining of human cerebral cortex, colon, kidney and lymph node using Anti-ARHGAP25 antibody NBP2-57228 (A) shows similar protein distribution across tissues to independent antibody NBP1-83053 (B).
Immunohistochemistry-Paraffin: ARHGAP25 Antibody [NBP2-57228]

Immunohistochemistry-Paraffin: ARHGAP25 Antibody [NBP2-57228]

Immunohistochemistry-Paraffin: ARHGAP25 Antibody [NBP2-57228] - Staining of human colon.
Immunohistochemistry-Paraffin: ARHGAP25 Antibody [NBP2-57228]

Immunohistochemistry-Paraffin: ARHGAP25 Antibody [NBP2-57228]

Immunohistochemistry-Paraffin: ARHGAP25 Antibody [NBP2-57228] - Staining of human lymph node.
Immunohistochemistry-Paraffin: ARHGAP25 Antibody [NBP2-57228]

Immunohistochemistry-Paraffin: ARHGAP25 Antibody [NBP2-57228]

Immunohistochemistry-Paraffin: ARHGAP25 Antibody [NBP2-57228] - Staining of human cerebral cortex using Anti-ARHGAP25 antibody NBP2-57228.

Applications for ARHGAP25 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ARHGAP25

ARHGAPs, such as ARHGAP25, encode negative regulators of Rho GTPases (see ARHA; MIM 165390), which are implicated in actin remodeling, cell polarity, and cell migration (Katoh and Katoh, 2004 [PubMed 15254788]).[supplied by OMIM]

Alternate Names

KAIA0053, KIAA0053, Rho GTPase activating protein 25, rho GTPase-activating protein 25, Rho-type GTPase-activating protein 25

Gene Symbol

ARHGAP25

Additional ARHGAP25 Products

Product Documents for ARHGAP25 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ARHGAP25 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for ARHGAP25 Antibody - BSA Free

Customer Reviews for ARHGAP25 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ARHGAP25 Antibody - BSA Free and earn rewards!

Have you used ARHGAP25 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...