ARVCF Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38999

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: DDTRSLAADDEGGPELEPDYGTATRRRPECGRGLHTRAYEDTADDGGELADERPAFPMVTAP

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (81%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ARVCF Antibody - BSA Free

Western Blot: ARVCF Antibody [NBP2-38999]

Western Blot: ARVCF Antibody [NBP2-38999]

Western Blot: ARVCF Antibody [NBP2-38999] - Analysis in human cell lines U2OS and HeLa. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Immunocytochemistry/ Immunofluorescence: ARVCF Antibody [NBP2-38999]

Immunocytochemistry/ Immunofluorescence: ARVCF Antibody [NBP2-38999]

Immunocytochemistry/Immunofluorescence: ARVCF Antibody [NBP2-38999] - Immunofluorescent staining of human cell line SH-SY5Y shows localization to plasma membrane & cell junctions.
Immunohistochemistry-Paraffin: ARVCF Antibody [NBP2-38999]

Immunohistochemistry-Paraffin: ARVCF Antibody [NBP2-38999]

Immunohistochemistry-Paraffin: ARVCF Antibody [NBP2-38999] - Staining of human prostate shows moderate membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: ARVCF Antibody [NBP2-38999]

Immunohistochemistry-Paraffin: ARVCF Antibody [NBP2-38999]

Immunohistochemistry-Paraffin: ARVCF Antibody [NBP2-38999] - Staining of human cerebellum shows strong cytoplasmic positivity in a subset of cells in granular layer.
Immunohistochemistry-Paraffin: ARVCF Antibody [NBP2-38999]

Immunohistochemistry-Paraffin: ARVCF Antibody [NBP2-38999]

Immunohistochemistry-Paraffin: ARVCF Antibody [NBP2-38999] - Staining of human epididymis shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: ARVCF Antibody [NBP2-38999]

Immunohistochemistry-Paraffin: ARVCF Antibody [NBP2-38999]

Immunohistochemistry-Paraffin: ARVCF Antibody [NBP2-38999] - Staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: ARVCF Antibody [NBP2-38999]

Immunohistochemistry-Paraffin: ARVCF Antibody [NBP2-38999]

Immunohistochemistry-Paraffin: ARVCF Antibody [NBP2-38999] - Staining of human liver shows no positivity in hepatocytes as expected.

Applications for ARVCF Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ARVCF

Armadillo Repeat gene deleted in Velo-Cardio-Facial syndrome (ARVCF) is a member of the catenin family which play an important role in the formation of adherens junction complexes, which are thought to facilitate communication between the inside and outside environments of a cell. ARVCF gene was isolated in the search for the genetic defect responsible for the autosomal dominant Velo-Cardio-Facial syndrome (VCFS) a relatively common human disorder with phenotypic features including cleft palate, conotruncal heart defects and facial dysmorphology. ARVCF gene encodes a protein containing two motifs, a coiled coil domain in the N-terminus and a 10 armadillo repeat sequence in the midregion. Since these sequences can facilitate protein-protein interactions ARVCF is thought to function in a protein complex. In addition, ARVCF contains a predicted nuclear-targeting sequence suggesting that it may have a function as a nuclear protein.

Alternate Names

armadillo repeat gene deleted in velocardiofacial syndrome, armadillo repeat protein deleted in velo-cardio-facial syndrome, FLJ35345

Gene Symbol

ARVCF

UniProt

Additional ARVCF Products

Product Documents for ARVCF Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ARVCF Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ARVCF Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ARVCF Antibody - BSA Free and earn rewards!

Have you used ARVCF Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...