ASB7 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-86157
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Validated:
Human
Cited:
Mouse
Predicted:
Rat (100%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HHHCRRNPELQEELQIQAAVAAGDVHTVRKMLEQGYSPNGRDANGWTLLHFSAARGKERCVRVFLEHGADPTVKDLIGGFTALHYAAMHGRARIARLMLESEYRSDIINAKSNDGWTPLHVAAHYGRDSFVRLLLEFKAEVDPLSDK
Reactivity Notes
Mouse reactivity reported in scientific literature (PMID:33251222)
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for ASB7 Antibody - BSA Free
Immunohistochemistry-Paraffin: ASB7 Antibody [NBP1-86157]
Immunohistochemistry-Paraffin: ASB7 Antibody [NBP1-86157] - Staining of human testis shows high expression.Immunohistochemistry-Paraffin: ASB7 Antibody - BSA Free [NBP1-86157]
Staining of human pancreas shows low expression as expected.Western Blot: ASB7 Antibody - BSA Free [NBP1-86157]
Analysis in control (vector only transfected HEK293T lysate) and aSB7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).Western Blot: ASB7 Antibody - BSA Free [NBP1-86157] -
ASB7 overexpression alleviates maternal age-induced oocyte meiotic defects. (A) Representative Western blot showing the ASB7 expression in oocytes from young and old mice (100 oocytes per lane). (B) Schematic illustration of the experimental procedure for overexpression. (C) Representative Western blot result shows the efficiently overexpressed exogenous ASB7 protein. (D) Young, old, old + PBS, and old + ASB7 oocytes were stained with alpha -tubulin antibody to visualize spindle (green) and counterstained with PI to visualize chromosome (red). Yellow arrowheads direct to the disorganized spindles and white arrows indicate the misaligned chromosomes. Scale bar: 30 μm. (E) Quantification of young (n = 103), old (n = 112), old + PBS (n = 115), and old + ASB7 (n = 104) oocytes with spindle/chromosome defects. (F) Chromosome spread of young, old, old + PBS, and old + ASB7 MII oocytes. Chromosomes were stained with Hoechst 33342 (blue), and kinetochores were labeled with CREST (purple). Scale bar: 10 μm. (G) Quantification of aneuploidy in young (n = 35), old (n = 38), old + PBS (n = 34), and old + ASB7 (n = 32) oocytes. Data are expressed as mean percentage +/- SEM of three independent experiments. *p < 0.05 vs controls. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/33251222), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for ASB7 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Western Blot
0.04-0.4 ug/ml
Application Notes
IHC-P, Retrieval method: HIER pH6, ICC/IF, Fixation/Permeabilization: PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: ASB7
Alternate Names
ankyrin repeat and SOCS box containing 7, ankyrin repeat and SOCS box protein 7, ankyrin repeat and SOCS box-containing 7, ASB-7, FLJ22551, FLJ25192
Gene Symbol
ASB7
Additional ASB7 Products
Product Documents for ASB7 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for ASB7 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for ASB7 Antibody - BSA Free
Customer Reviews for ASB7 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review ASB7 Antibody - BSA Free and earn rewards!
Have you used ASB7 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...