ASC1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35533

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ASC1 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 282-581 of human ASC1 (NP_057297.2).

Sequence:
VIDDESDYFASDSNQWLSKLERETLQKREEELRELRHASRLSKKVTIDFAGRKILEEENSLAEYHSRLDETIQAIANGTLNQPLTKLDRSSEEPLGVLVNPNMYQSPPQWVDHTGAASQKKAFRSSGFGLEFNSFQHQLRIQDQEFQEGFDGGWCLSVHQPWASLLVRGIKRVEGRSWYTPHRGRLWIAATAKKPSPQEVSELQATYRLLRGKDVEFPNDYPSGCLLGCVDLIDCLSQKQFKEQFPDISQESDSPFVFICKNPQEMVVKFPIKGNPKIWKLDSKIHQGAKKGLMKQNKAV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

66 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ASC1 Antibody - BSA Free

ASC1 Antibody

Western Blot: ASC1 Antibody [NBP3-35533] -

Western Blot: ASC1 Antibody [NBP3-35533] - Western blot analysis of various lysates using ASC1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
ASC1 Antibody

Immunoprecipitation: ASC1 Antibody [NBP3-35533] -

Immunoprecipitation: ASC1 Antibody [NBP3-35533] - Immunoprecipitation analysis of 200 ug extracts of A-549 cells using 3 ug ASC1 antibody. Western blot was performed from the immunoprecipitate using ASC1 antibody at a dilution of 1:1000.
ASC1 Antibody

Immunohistochemistry: ASC1 Antibody [NBP3-35533] -

Immunohistochemistry: ASC1 Antibody [NBP3-35533] - Immunohistochemistry analysis of paraffin-embedded Rat heart using ASC1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
ASC1 Antibody

Immunohistochemistry: ASC1 Antibody [NBP3-35533] -

Immunohistochemistry: ASC1 Antibody [NBP3-35533] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using ASC1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
ASC1 Antibody

Immunohistochemistry: ASC1 Antibody [NBP3-35533] -

Immunohistochemistry: ASC1 Antibody [NBP3-35533] - Immunohistochemistry analysis of paraffin-embedded Human esophageal using ASC1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Applications for ASC1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry-Paraffin

1:50 - 1:200

Immunoprecipitation

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ASC1

Alternate Names

activating signal cointegrator 1, ASC-1, HsT17391, thyroid hormone receptor interactor 4, thyroid receptor interacting protein 4, Thyroid receptor-interacting protein 4, TR-interacting protein 4, TRIP-4

Gene Symbol

TRIP4

Additional ASC1 Products

Product Documents for ASC1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ASC1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ASC1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ASC1 Antibody - BSA Free and earn rewards!

Have you used ASC1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies