Ataxin-2 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-90063
Loading...
Key Product Details
Validated by
Orthogonal Validation, Independent Antibodies
Species Reactivity
Validated:
Human
Cited:
Human, Mouse
Predicted:
Rat (96%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence
Cited:
Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TPPAYSTQYVAYSPQQFPNQPLVQHVPHYQSQHPHVYSPVIQGNARMMAPPTHAQPGLVSSSATQYGAHEQTHAMYACPKLPYNKETSPSFYFAISTGSLAQQYAHPNATLHPHTPHPQPSATPTGQQQSQHGGSHPAPS
Reactivity Notes
Mouse reactivity reported in (PMID: 36288714).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Ataxin-2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: Ataxin-2 Antibody [NBP1-90063]
Immunocytochemistry/Immunofluorescence: Ataxin-2 Antibody [NBP1-90063] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.Immunohistochemistry-Paraffin: Ataxin-2 Antibody [NBP1-90063]
Immunohistochemistry-Paraffin: Ataxin-2 Antibody [NBP1-90063] - Staining of human cerebellum, cerebral cortex, skeletal muscle and testis using Anti-Ataxin-2 antibody NBP1-90063 (A) shows similar protein distribution across tissues to independent antibody NBP1-90062 (B).Immunohistochemistry-Paraffin: Ataxin-2 Antibody [NBP1-90063]
Immunohistochemistry-Paraffin: Ataxin-2 Antibody [NBP1-90063] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.Immunohistochemistry-Paraffin: Ataxin-2 Antibody [NBP1-90063]
Immunohistochemistry-Paraffin: Ataxin-2 Antibody [NBP1-90063] - Staining of human skeletal muscle shows no positivity in myocytes as expected.Immunohistochemistry-Paraffin: Ataxin-2 Antibody [NBP1-90063]
Immunohistochemistry-Paraffin: Ataxin-2 Antibody [NBP1-90063] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.Immunohistochemistry-Paraffin: Ataxin-2 Antibody [NBP1-90063]
Immunohistochemistry-Paraffin: Ataxin-2 Antibody [NBP1-90063] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.Applications for Ataxin-2 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Please note that WB is no longer validated for the current lot of this antibody. The publications that cite use of this product in WB were for previous lots. The antibody may work in WB but we do not guarantee it any longer.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Store at -20C long term. Avoid freeze-thaw cycles.
Background: Ataxin-2
Alternate Names
ataxin 2, ataxin 2), ataxin-2, ATX2spinocerebellar ataxia 2 (olivopontocerebellar ataxia 2, autosomal dominant, SCA2FLJ46772, Spinocerebellar ataxia type 2 protein, TNRC13, trinucleotide repeat containing 13, Trinucleotide repeat-containing gene 13 protein
Gene Symbol
ATXN2
Additional Ataxin-2 Products
Product Documents for Ataxin-2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Ataxin-2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for Ataxin-2 Antibody - BSA Free
Customer Reviews for Ataxin-2 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Ataxin-2 Antibody - BSA Free and earn rewards!
Have you used Ataxin-2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...