ATP5A Antibody (6M3B8)
Novus Biologicals | Catalog # NBP3-15355
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Simple Western, Immunoprecipitation
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 6M3B8 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ATP5A (P25705). VPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGSDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYF
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for ATP5A Antibody (6M3B8)
Western Blot: ATP5A Antibody (6M3B8) [NBP3-15355]
Western Blot: ATP5A Antibody (6M3B8) [NBP3-15355] - Analysis of extracts of various cell lines, using ATP5A Rabbit mAb (NBP3-15355) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.Simple Western: ATP5A Antibody (6M3B8) [NBP3-15355] -
Simple Western: ATP5A Antibody (6M3B8) [NBP3-15355] - ATP5A Antibodies (NBP3-15355), ProteinSimple Western Blot on Jess Instrument; 1, 0.5, and 0.2 microgram of human brain tissue lysate was tested with the antibodies diluted 20 times. Image from verified customer review.Immunocytochemistry/Immunofluorescence: ATP5A Antibody (6M3B8) [NBP3-15355] -
Immunocytochemistry/Immunofluorescence: ATP5A Antibody (6M3B8) [NBP3-15355] - Confocal imaging of NIH/3T3 cells using ATP5A1 Rabbit mAb (dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (dilution 1:500) (Red). The cells were counterstained with alpha -Tubulin Mouse mAb (dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.Immunohistochemistry-Paraffin: ATP5A Antibody (6M3B8) [NBP3-15355] -
Immunohistochemistry-Paraffin: ATP5A Antibody (6M3B8) [NBP3-15355] -Rat brain tissue using ATP5A1 Rabbit mAb (dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.Immunohistochemistry-Paraffin: ATP5A Antibody (6M3B8) [NBP3-15355] -
Immunohistochemistry-Paraffin: ATP5A Antibody (6M3B8) [NBP3-15355] - Mouse brain tissue using ATP5A1 Rabbit mAb (dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) ( dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.Immunocytochemistry/Immunofluorescence: ATP5A Antibody (6M3B8) [NBP3-15355] -
Immunocytochemistry/Immunofluorescence: ATP5A Antibody (6M3B8) [NBP3-15355] - Confocal imaging of HeLa cells using ATP5A1 Rabbit mAb (dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (dilution 1:500) (Red). The cells were counterstained with alpha -Tubulin Mouse mAb (dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.Immunohistochemistry: ATP5A Antibody (6M3B8) [ATP5A] -
Immunohistochemistry: ATP5A Antibody (6M3B8) [ATP5A] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using ATP5A Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.Immunocytochemistry/ Immunofluorescence: ATP5A Antibody (6M3B8) [ATP5A] -
Immunocytochemistry/ Immunofluorescence: ATP5A Antibody (6M3B8) [ATP5A] - Confocal imaging of paraffin-embedded Mouse brain tissue using ATP5A Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.Immunocytochemistry/ Immunofluorescence: ATP5A Antibody (6M3B8) [ATP5A] -
Immunocytochemistry/ Immunofluorescence: ATP5A Antibody (6M3B8) [ATP5A] - Confocal imaging of NIH/3T3 cells using ATP5A Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.Immunohistochemistry: ATP5A Antibody (6M3B8) [ATP5A] -
Immunohistochemistry: ATP5A Antibody (6M3B8) [ATP5A] - Immunohistochemistry analysis of paraffin-embedded Human lung squamous carcinoma tissue using ATP5A Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.Immunohistochemistry: ATP5A Antibody (6M3B8) [ATP5A] -
Immunohistochemistry: ATP5A Antibody (6M3B8) [ATP5A] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using ATP5A Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.Immunocytochemistry/ Immunofluorescence: ATP5A Antibody (6M3B8) [ATP5A] -
Immunocytochemistry/ Immunofluorescence: ATP5A Antibody (6M3B8) [ATP5A] - Confocal imaging of paraffin-embedded Rat brain tissue using ATP5A Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.Immunocytochemistry/ Immunofluorescence: ATP5A Antibody (6M3B8) [ATP5A] -
Immunocytochemistry/ Immunofluorescence: ATP5A Antibody (6M3B8) [ATP5A] - Confocal imaging of HeLa cells using ATP5A Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.Immunoprecipitation: ATP5A Antibody (6M3B8) [ATP5A] -
Immunoprecipitation: ATP5A Antibody (6M3B8) [ATP5A] - Immunoprecipitation analysis of 600 ug extracts of Mouse heart using 3 ug ATP5A antibody. Western blot was performed from the immunoprecipitate using ATP5A antibody at a dilution of 1:1000.Immunohistochemistry: ATP5A Antibody (6M3B8) [ATP5A] -
Immunohistochemistry: ATP5A Antibody (6M3B8) [ATP5A] - Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using ATP5A Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.Immunohistochemistry: ATP5A Antibody (6M3B8) [ATP5A] -
Immunohistochemistry: ATP5A Antibody (6M3B8) [ATP5A] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using ATP5A Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.Immunohistochemistry: ATP5A Antibody (6M3B8) [ATP5A] -
Immunohistochemistry: ATP5A Antibody (6M3B8) [ATP5A] - Immunohistochemistry analysis of paraffin-embedded Rat liver tissue using ATP5A Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.Applications for ATP5A Antibody (6M3B8)
Application
Recommended Usage
ELISA
,Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Immunocytochemistry/ Immunofluorescence
1:200 - 1:2000
Immunohistochemistry
1:200 - 1:2000
Immunohistochemistry-Paraffin
1:200 - 1:2000
Immunoprecipitation
0.5μg-4μg antibody for 400μg-600μg extracts of whole cells
Western Blot
1:1000 - 1:6000
Application Notes
See Simple Western Antibody Database for Simple Western validation
Reviewed Applications
Read 1 review rated 5 using NBP3-15355 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: ATP5A
Long Name
ATP5A1
Alternate Names
ATP synthase alpha chain, mitochondrial, ATP synthase subunit alpha, mitochondrial, ATP synthase, H+ transporting, mitochondrial F1 co, ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit 1, ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit, isoform1, cardiac muscle, ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit, isoform2, non-cardiac muscle-like 2, ATP sythase (F1-ATPase) alpha subunit, ATP5A, ATP5A1, ATP5AL2, ATP5AMOM2, ATPM, ATPMATP synthase subunit alpha, mitochondrial, cardiac muscle, COXPD22, EC 3.6.3, EC 3.6.3.14, epididymis secretory sperm binding protein Li 123m, hATP1, HEL-S-123m, MC5DN4, MC5DN4A, MC5DN4B, mitochondrial ATP synthetase, oligomycin-resistant, MOM2, OMR, ORM, ORMATP synthase alpha chain, mitochondrial
Gene Symbol
ATP5F1A
Additional ATP5A Products
Product Documents for ATP5A Antibody (6M3B8)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for ATP5A Antibody (6M3B8)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for ATP5A Antibody (6M3B8) (1)
5 out of 5
1 Customer Rating
Have you used ATP5A Antibody (6M3B8)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
1 的
1 review
Showing All
Filter By:
-
Application: Simple WesternSample Tested: human brain lysateSpecies: HumanVerified Customer | Posted 04/06/2023ATP5A Antibodies NBP3-15355, ProteinSimple Western Blot on Jess Instrument; 1, 0.5, and 0.2 microgram of human brain tissue lysate was tested with the antibodies diluted 20 times.Bio-Techne ResponseThis review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Immunoprecipitation Protocol
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...