ATP6V1B1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33962

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: MAMEIDSRPGGLPGSSCNLGAAREHMQAVTRNYITHPRVTYRTVCSVNGPLVVLDRVKFAQYAEIV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ATP6V1B1 Antibody - BSA Free

Western Blot: ATP6V1B1 Antibody [NBP2-33962]

Western Blot: ATP6V1B1 Antibody [NBP2-33962]

Western Blot: ATP6V1B1 Antibody [NBP2-33962] - Analysis in human cell line SK-BR-3.
Immunohistochemistry-Paraffin: ATP6V1B1 Antibody [NBP2-33962]

Immunohistochemistry-Paraffin: ATP6V1B1 Antibody [NBP2-33962]

Immunohistochemistry-Paraffin: ATP6V1B1 Antibody [NBP2-33962] - Staining in human kidney and liver tissues. Corresponding ATP6V1B1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ATP6V1B1 Antibody [NBP2-33962]

Immunohistochemistry-Paraffin: ATP6V1B1 Antibody [NBP2-33962]

Immunohistochemistry-Paraffin: ATP6V1B1 Antibody [NBP2-33962] - Staining of human breast shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ATP6V1B1 Antibody [NBP2-33962]

Immunohistochemistry-Paraffin: ATP6V1B1 Antibody [NBP2-33962]

Immunohistochemistry-Paraffin: ATP6V1B1 Antibody [NBP2-33962] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in distal tubules.
Immunohistochemistry-Paraffin: ATP6V1B1 Antibody [NBP2-33962]

Immunohistochemistry-Paraffin: ATP6V1B1 Antibody [NBP2-33962]

Immunohistochemistry-Paraffin: ATP6V1B1 Antibody [NBP2-33962] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: ATP6V1B1 Antibody [NBP2-33962]

Immunohistochemistry-Paraffin: ATP6V1B1 Antibody [NBP2-33962]

Immunohistochemistry-Paraffin: ATP6V1B1 Antibody [NBP2-33962] - Staining of human salivary gland shows strong cytoplasmic positivity in ductal cells.

Applications for ATP6V1B1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ATP6V1B1

ATP6V1B1 encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is one of two V1 domain B subunit isoforms and is found in the kidney. Mutations in this gene cause distal renal tubular acidosis associated with sensorineural deafness. [provided by RefSeq]

Alternate Names

ATP6B158kD subunit, ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B1, Endomembrane proton pump 58 kDa subunit, H+-ATPase beta 1 subunit, vacuolar proton pump 3, Vacuolar proton pump subunit B 1, vacuolar proton pump, subunit 3, VATBMGC32642, V-ATPase B1 subunit, V-ATPase subunit B 1, Vma2, V-type proton ATPase subunit B, kidney isoform

Gene Symbol

ATP6V1B1

UniProt

Additional ATP6V1B1 Products

Product Documents for ATP6V1B1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ATP6V1B1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ATP6V1B1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ATP6V1B1 Antibody - BSA Free and earn rewards!

Have you used ATP6V1B1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...