ATP8A1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-30403

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ATP8A1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: KSQDPGAVVLGKSLTERAQLLKNVFKKNHVNLYRSESLQQNLLHGYAFSQDENGIVSQSEVI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ATP8A1 Antibody - BSA Free

Immunohistochemistry-Paraffin: ATP8A1 Antibody [NBP2-30403]

Immunohistochemistry-Paraffin: ATP8A1 Antibody [NBP2-30403]

Immunohistochemistry-Paraffin: ATP8A1 Antibody [NBP2-30403] - Analysis in human cerebral cortex and liver tissues. Corresponding ATP8A1 RNA-seq data are presented for the same tissues.
Western Blot: ATP8A1 Antibody [NBP2-30403]

Western Blot: ATP8A1 Antibody [NBP2-30403]

Western Blot: ATP8A1 Antibody [NBP2-30403] - Analysis in human cell line Daudi.
Immunocytochemistry/ Immunofluorescence: ATP8A1 Antibody [NBP2-30403]

Immunocytochemistry/ Immunofluorescence: ATP8A1 Antibody [NBP2-30403]

Immunocytochemistry/Immunofluorescence: ATP8A1 Antibody [NBP2-30403] - Staining of human cell line PC-3 shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ATP8A1 Antibody [NBP2-30403]

Immunohistochemistry-Paraffin: ATP8A1 Antibody [NBP2-30403]

Immunohistochemistry-Paraffin: ATP8A1 Antibody [NBP2-30403] - Staining of human small intestine shows moderate membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: ATP8A1 Antibody [NBP2-30403]

Immunohistochemistry-Paraffin: ATP8A1 Antibody [NBP2-30403]

Immunohistochemistry-Paraffin: ATP8A1 Antibody [NBP2-30403] - Staining of human cerebral cortex shows strong membranous and cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: ATP8A1 Antibody [NBP2-30403]

Immunohistochemistry-Paraffin: ATP8A1 Antibody [NBP2-30403]

Immunohistochemistry-Paraffin: ATP8A1 Antibody [NBP2-30403] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: ATP8A1 Antibody [NBP2-30403]

Immunohistochemistry-Paraffin: ATP8A1 Antibody [NBP2-30403]

Immunohistochemistry-Paraffin: ATP8A1 Antibody [NBP2-30403] - Staining of human lymph node shows moderate membranous positivity in germinal center cells.

Applications for ATP8A1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ATP8A1

The P-type adenosinetriphosphatases (P-type ATPases) are a family of proteins which use the free energy of ATP hydrolysis to drive uphill transport of ions across membranes. Several subfamilies of P-type ATPases have been identified. One subfamily catalyzes transport of heavy metal ions. Another subfamily transports non-heavy metal ions (NMHI). The protein encoded by this gene is a member of the third subfamily of P-type ATPases and acts to transport amphipaths, such as phosphatidylserine. Two transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Alternate Names

ATPase, aminophospholipid transporter (APLT), class I, type 8A, member 1, ATPASEII, ATPIA, ATPP2, probable phospholipid-transporting ATPase IA

Gene Symbol

ATP8A1

UniProt

Q9Y2Q0 (Human)

Additional ATP8A1 Products

Product Documents for ATP8A1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ATP8A1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ATP8A1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ATP8A1 Antibody - BSA Free and earn rewards!

Have you used ATP8A1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies