ATPase Na+/K+ beta 3 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # H00000483-B01P

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Cited:

Mouse

Applications

Validated:

Western Blot, Flow Cytometry, Immunocytochemistry/ Immunofluorescence

Cited:

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Mouse IgG

Format

Azide and BSA Free
View all ATPase Na+/K+ beta 3 Primary Antibodies »

Product Specifications

Immunogen

ATP1B3 (NP_001670.1, 1 a.a. - 279 a.a.) full-length human protein. MTKNEKKSLNQSLAEWKLFIYNPTTGEFLGRTAKSWGLILLFYLVFYGFLAALFSFTMWVMLQTLNDEVPKYRDQIPSPGLMVFPKPVTALEYTFSRSDPTSYAGYIEDLKKFLKPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGVPRIDCVSKNEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFKITARA

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 31009649).

Specificity

ATP1B3 - ATPase, Na+/K+ transporting, beta 3 polypeptide,

Clonality

Polyclonal

Host

Mouse

Isotype

IgG

Description

Quality control test: Antibody reactive against mammalian transfected lysate.

Scientific Data Images for ATPase Na+/K+ beta 3 Antibody - Azide and BSA Free

Western Blot: ATPase Na+/K+ beta 3 Antibody [H00000483-B01P]

Western Blot: ATPase Na+/K+ beta 3 Antibody [H00000483-B01P]

Western Blot: ATPase Na+/K+ beta 3 Antibody [H00000483-B01P] - Analysis of ATP1B3 expression in A-431.
Flow Cytometry: ATPase Na+/K+ beta 3 Antibody [H00000483-B01P]

Flow Cytometry: ATPase Na+/K+ beta 3 Antibody [H00000483-B01P]

Flow Cytometry: ATPase Na+/K+ beta 3 Antibody [H00000483-B01P] - Analysis of negative control 293 cells (Black) and ATP1B3 expressing 293 cells (Green) using ATP1B3 purified mouse polyclonal antibody.
Western Blot: ATPase Na+/K+ beta 3 Antibody [H00000483-B01P]

Western Blot: ATPase Na+/K+ beta 3 Antibody [H00000483-B01P]

Western Blot: ATPase Na+/K+ beta 3 Antibody [H00000483-B01P] - Analysis of ATP1B3 expression in transfected 293T cell line by ATP1B3 polyclonal antibody. Lane 1: ATP1B3 transfected lysate(30.69 KDa). Lane 2: Non-transfected lysate.

Applications for ATPase Na+/K+ beta 3 Antibody - Azide and BSA Free

Application
Recommended Usage

Flow Cytometry

Optimal dilutions of this antibody should be experimentally determined.

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
GST tag alone is used as a negative control. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID: 31009649).

Flow Cytometry Panel Builder

Bio-Techne Knows Flow Cytometry

Save time and reduce costly mistakes by quickly finding compatible reagents using the Panel Builder Tool.

Advanced Features

  • Spectra Viewer - Custom analysis of spectra from multiple fluorochromes
  • Spillover Popups - Visualize the spectra of individual fluorochromes
  • Antigen Density Selector - Match fluorochrome brightness with antigen density
Build Your Panel Now
Flow Cytometry

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS (pH 7.4)

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: ATPase Na+/K+ beta 3

The protein encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 3 subunit. This gene encodes a beta 3 subunit. A pseudogene exists for this gene, and it is located on chromosome 2. [provided by RefSeq]

Long Name

Sodium/potassium-transporting ATPase subunit beta-3

Alternate Names

ATP1B3, ATPB-3, CD antigen CD298

Entrez Gene IDs

483 (Human)

Gene Symbol

ATP1B3

UniProt

NP_001670.1 (Human)

Additional ATPase Na+/K+ beta 3 Products

Product Documents for ATPase Na+/K+ beta 3 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ATPase Na+/K+ beta 3 Antibody - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for ATPase Na+/K+ beta 3 Antibody - Azide and BSA Free

Customer Reviews for ATPase Na+/K+ beta 3 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review ATPase Na+/K+ beta 3 Antibody - Azide and BSA Free and earn rewards!

Have you used ATPase Na+/K+ beta 3 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies