beta 2-Microglobulin Antibody (3F9-2C2) - Azide and BSA Free
Novus Biologicals | Catalog # H00000567-M01
![Western Blot: beta 2-Microglobulin Antibody (3F9-2C2) [H00000567-M01]](https://beta-resources.rndsystems.com/images/products/beta-2-Microglobulin-Antibody-3F9-2C2-Western-Blot-H00000567-M01-img0015.jpg "Western Blot: beta 2-Microglobulin Antibody (3F9-2C2) [H00000567-M01]")
Loading...
Key Product Details
Species Reactivity
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Proximity Ligation Assay, Knockdown Validated
Cited:
IF/IHC
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG2b Kappa Clone # 3F9-2C2
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
B2M (AAH32589, 1 a.a. ~ 119 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
Specificity
B2M - beta-2-microglobulin
Clonality
Monoclonal
Host
Mouse
Isotype
IgG2b Kappa
Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Scientific Data Images for beta 2-Microglobulin Antibody (3F9-2C2) - Azide and BSA Free
Western Blot: beta 2-Microglobulin Antibody (3F9-2C2) [H00000567-M01]
Western Blot: beta 2-Microglobulin Antibody (3F9-2C2) [H00000567-M01] - Analysis of B2M expression in transfected 293T cell line by B2M monoclonal antibody (M01), clone 3F9-2C2.Lane 1: B2M transfected lysate(13.7 KDa).Lane 2: Non-transfected lysate.![Immunocytochemistry/ Immunofluorescence: beta 2-Microglobulin Antibody (3F9-2C2) [H00000567-M01]](https://beta-resources.rndsystems.com/images/products/beta-2-Microglobulin-Antibody-3F9-2C2-Immunocytochemistry-Immunofluorescence-H00000567-M01-img0009.jpg "Immunocytochemistry/ Immunofluorescence: beta 2-Microglobulin Antibody (3F9-2C2) [H00000567-M01]")
Immunocytochemistry/ Immunofluorescence: beta 2-Microglobulin Antibody (3F9-2C2) [H00000567-M01]
Immunocytochemistry/Immunofluorescence: beta 2-Microglobulin Antibody (3F9-2C2) [H00000567-M01] - Analysis of monoclonal antibody to B2M on HeLa cell. Antibody concentration 10 ug/ml.![Immunohistochemistry-Paraffin: beta 2-Microglobulin Antibody (3F9-2C2) [H00000567-M01]](https://beta-resources.rndsystems.com/images/products/beta-2-Microglobulin-Antibody-3F9-2C2-Immunohistochemistry-Paraffin-H00000567-M01-img0011.jpg "Immunohistochemistry-Paraffin: beta 2-Microglobulin Antibody (3F9-2C2) [H00000567-M01]")
Immunohistochemistry-Paraffin: beta 2-Microglobulin Antibody (3F9-2C2) [H00000567-M01]
Immunohistochemistry-Paraffin: beta 2-Microglobulin Antibody (3F9-2C2) [H00000567-M01] - Analysis of monoclonal antibody to B2M on formalin-fixed paraffin-embedded human esophagus. Antibody concentration 3 ug/ml.![Western Blot: beta 2-Microglobulin Antibody (3F9-2C2) [H00000567-M01]](https://beta-resources.rndsystems.com/images/products/beta-2-Microglobulin-Antibody-3F9-2C2-Western-Blot-H00000567-M01-img0012.jpg "Western Blot: beta 2-Microglobulin Antibody (3F9-2C2) [H00000567-M01]")
Western Blot: beta 2-Microglobulin Antibody (3F9-2C2) [H00000567-M01]
Western Blot: beta 2-Microglobulin Antibody (3F9-2C2) [H00000567-M01] - Analysis of B2M over-expressed 293 cell line, cotransfected with B2M Validated Chimera RNAi ( Cat # H00000567-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with B2M monoclonal antibody (M01), clone 3F9-2C2 (Cat # H00000567-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.![Western Blot: beta 2-Microglobulin Antibody (3F9-2C2) [H00000567-M01]](https://beta-resources.rndsystems.com/images/products/beta-2-Microglobulin-Antibody-3F9-2C2-Western-Blot-H00000567-M01-img0014.jpg "Western Blot: beta 2-Microglobulin Antibody (3F9-2C2) [H00000567-M01]")
Western Blot: beta 2-Microglobulin Antibody (3F9-2C2) [H00000567-M01]
Western Blot: beta 2-Microglobulin Antibody (3F9-2C2) [H00000567-M01] - B2M monoclonal antibody (M01), clone 3F9-2C2 Analysis of B2M expression in U-2 OS.![Proximity Ligation Assay: beta 2-Microglobulin Antibody (3F9-2C2) [H00000567-M01]](https://beta-resources.rndsystems.com/images/products/beta-2-Microglobulin-Antibody-3F9-2C2-Proximity-Ligation-Assay-H00000567-M01-img0007.jpg "Proximity Ligation Assay: beta 2-Microglobulin Antibody (3F9-2C2) [H00000567-M01]")
Proximity Ligation Assay: beta 2-Microglobulin Antibody (3F9-2C2) [H00000567-M01]
Proximity Ligation Assay: beta 2-Microglobulin Antibody (3F9-2C2) [H00000567-M01] - Analysis of protein-protein interactions between CALR and B2M. HeLa cells were stained with anti-CALR rabbit purified polyclonal 1:1200 and anti-B2M mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).![ELISA: beta 2-Microglobulin Antibody (3F9-2C2) [H00000567-M01]](https://beta-resources.rndsystems.com/images/products/beta-2-Microglobulin-Antibody-3F9-2C2-ELISA-H00000567-M01-img0016.jpg "ELISA: beta 2-Microglobulin Antibody (3F9-2C2) [H00000567-M01]")
ELISA: beta 2-Microglobulin Antibody (3F9-2C2) [H00000567-M01]
ELISA: beta 2-Microglobulin Antibody (3F9-2C2) [H00000567-M01] - Detection limit for recombinant GST tagged B2M is approximately 0.03ng/ml as a capture antibody.Applications for beta 2-Microglobulin Antibody (3F9-2C2) - Azide and BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:10-1:500
Immunohistochemistry
1:10-1:500
Immunohistochemistry-Paraffin
1:10-1:500
Western Blot
1:500
Application Notes
Antibody reactivity against recominant protein and cell lysate for WB. It has been used for IF, IHC-P, RNAi Validation and ELISA.Use in Immunohistochemistry reported in scientific literature (PMID: 24736453).
Formulation, Preparation, and Storage
Purification
IgG purified
Formulation
In 1x PBS, pH 7.4
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: beta 2-Microglobulin
Alternate Names
B2M, beta 2Microglobulin
Entrez Gene IDs
567 (Human)
Gene Symbol
B2M
OMIM
109700 (Human)
UniProt
Additional beta 2-Microglobulin Products
Product Documents for beta 2-Microglobulin Antibody (3F9-2C2) - Azide and BSA Free
Product Specific Notices for beta 2-Microglobulin Antibody (3F9-2C2) - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for beta 2-Microglobulin Antibody (3F9-2C2) - Azide and BSA Free
Powered by Bioz
Customer Reviews for beta 2-Microglobulin Antibody (3F9-2C2) - Azide and BSA Free
There are currently no reviews for this product. Be the first to review beta 2-Microglobulin Antibody (3F9-2C2) - Azide and BSA Free and earn rewards!
Have you used beta 2-Microglobulin Antibody (3F9-2C2) - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...