BHMT2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85826

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: FTFSASEDNMESKWEDVNAAACDLAREVAGKGDALVAGGICQTSIYKYQKDEA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for BHMT2 Antibody - BSA Free

Immunohistochemistry-Paraffin: BHMT2 Antibody [NBP1-85826]

Immunohistochemistry-Paraffin: BHMT2 Antibody [NBP1-85826]

Immunohistochemistry-Paraffin: BHMT2 Antibody [NBP1-85826] - Staining in human kidney and lymph node tissues using anti-BHMT2 antibody. Corresponding BHMT2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: BHMT2 Antibody [NBP1-85826]

Immunohistochemistry-Paraffin: BHMT2 Antibody [NBP1-85826]

Immunohistochemistry-Paraffin: BHMT2 Antibody [NBP1-85826] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: BHMT2 Antibody [NBP1-85826]

Immunohistochemistry-Paraffin: BHMT2 Antibody [NBP1-85826]

Immunohistochemistry-Paraffin: BHMT2 Antibody [NBP1-85826] - Staining of human lymph node shows low expression as expected.
BHMT2 Antibody - BSA Free Western Blot: BHMT2 Antibody - BSA Free [NBP1-85826]

Western Blot: BHMT2 Antibody - BSA Free [NBP1-85826]

Lane 1: Mouse liver tissue lysate
Lane 2: Rat liver tissue lysate
BHMT2 Antibody - BSA Free Western Blot: BHMT2 Antibody - BSA Free [NBP1-85826]

Western Blot: BHMT2 Antibody - BSA Free [NBP1-85826]

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue

Applications for BHMT2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BHMT2

Homocysteine is a sulfur-containing amino acid that plays a crucial role in methylation reactions. Transfer of the methyl group from betaine to homocysteine creates methionine, which donates the methyl group to methylate DNA, proteins, lipids, and other intracellular metabolites. The protein encoded by this gene is one of two methyl transferases that can catalyze the transfer of the methyl group from betaine to homocysteine. Anomalies in homocysteine metabolism have been implicated in disorders ranging from vascular disease to neural tube birth defects such as spina bifida. [provided by RefSeq]

Alternate Names

betaine-homocysteine methyltransferase 2, betaine--homocysteine S-methyltransferase 2, EC 2.1.1.5, FLJ20001

Gene Symbol

BHMT2

Additional BHMT2 Products

Product Documents for BHMT2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for BHMT2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for BHMT2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BHMT2 Antibody - BSA Free and earn rewards!

Have you used BHMT2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for BHMT2 Antibody - BSA Free

Showing  1 - 11 FAQ Showing All
  • Q: I was looking at the BHMT2 antibody IHC image in brain tissue and I want to know where is this protein expressed? Cytosolic or nuclear ? the image you are showing does not have details.

    A: BHMT2 protein is not a very well published target and I do not see any research paper with its immuno-staining data. However, our antibodies NBP1-85826 and NBP2-15585 depicted a strong cytoplasmic staining with mild nuclear positivity for this target in IHC-P and ICC-IF assays. Human Protein Atlas also shows mainly cytoplasmic staining in hepatocytes, renal tubules, thyroid gland and a subset of cells in exocrine pancreas. Chadwick et al. (Genomics. 2000 Nov 15;70(1):66-73) reported that BHMT2 is expressed in liver and kidney, and at reduced levels in the brain, heart, and skeletal muscle.

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies
Loading...