Biglycan Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-84971

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Biological Validation

Species Reactivity

Validated:

Human, Mouse

Cited:

Human, Mouse

Predicted:

Rat (93%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: RGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSL

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:35008869).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Biglycan Antibody - BSA Free

Immunohistochemistry-Paraffin: Biglycan Antibody [NBP1-84971]

Immunohistochemistry-Paraffin: Biglycan Antibody [NBP1-84971]

Immunohistochemistry-Paraffin: Biglycan Antibody [NBP1-84971] - Analysis in human placenta and skeletal muscle tissues. Corresponding BGN RNA-seq data are presented for the same tissues.
Western Blot: Biglycan Antibody [NBP1-84971]

Western Blot: Biglycan Antibody [NBP1-84971]

Biglycan-Antibody-Western-Blot-NBP1-84971-img0019.jpg
Immunocytochemistry/ Immunofluorescence: Biglycan Antibody [NBP1-84971]

Immunocytochemistry/ Immunofluorescence: Biglycan Antibody [NBP1-84971]

Immunocytochemistry/Immunofluorescence: Biglycan Antibody [NBP1-84971] - Staining of human cell line BJ shows localization to endoplasmic reticulum & the Golgi apparatus. Antibody staining is shown in green.
Western Blot: Biglycan Antibody [NBP1-84971]

Western Blot: Biglycan Antibody [NBP1-84971]

Western Blot: Biglycan Antibody [NBP1-84971] - Analysis in human cell line U-138 MG.
Western Blot: Biglycan Antibody [NBP1-84971]

Western Blot: Biglycan Antibody [NBP1-84971]

Western Blot: Biglycan Antibody [NBP1-84971] - Analysis in control (vector only transfected HEK293T lysate) and BGN over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Biglycan Antibody [NBP1-84971]

Immunohistochemistry-Paraffin: Biglycan Antibody [NBP1-84971]

Immunohistochemistry-Paraffin: Biglycan Antibody [NBP1-84971] - Staining of human testis shows weak to moderate cytoplasmic positivity in peritubular myoid cells.
Immunohistochemistry-Paraffin: Biglycan Antibody [NBP1-84971]

Immunohistochemistry-Paraffin: Biglycan Antibody [NBP1-84971]

Immunohistochemistry-Paraffin: Biglycan Antibody [NBP1-84971] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: Biglycan Antibody [NBP1-84971]

Immunohistochemistry-Paraffin: Biglycan Antibody [NBP1-84971]

Immunohistochemistry-Paraffin: Biglycan Antibody [NBP1-84971] - Staining of human kidney shows moderate extracellular space positivity.
Immunohistochemistry-Paraffin: Biglycan Antibody [NBP1-84971]

Immunohistochemistry-Paraffin: Biglycan Antibody [NBP1-84971]

Immunohistochemistry-Paraffin: Biglycan Antibody [NBP1-84971] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Biglycan Antibody

Western Blot: Biglycan Antibody [NBP1-84971] -

Western Blot: Biglycan Antibody [NBP1-84971] - Treatment of CAFs with combined cytokines or cancer cell-derived secretomes affects ECM protein expression(A) Western blot showing the effects of bFGF, EGF & TGF-beta 1 treatment (10 ng/ml) on the expression of biglycan, decorin, alpha -SMA & versican in CAFs. (B) Western blot illustrating the effects of treatment with cancer cell-derived conditioned medium (CM) on the expression of biglycan, decorin, alpha -SMA & versican in CAFs. TGF-beta 1 treatment (1 & 10 ng/ml) was included as a positive control. Tubulin was used as loading control (A, B). Image collected & cropped by CiteAb from the following publication (https://www.oncoscience.us/lookup/doi/10.18632/oncoscience.87), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Biglycan Antibody

Western Blot: Biglycan Antibody [NBP1-84971] -

Western Blot: Biglycan Antibody [NBP1-84971] - Treatment of CAFs with combined cytokines or cancer cell-derived secretomes affects ECM protein expression(A) Western blot showing the effects of bFGF, EGF & TGF-beta 1 treatment (10 ng/ml) on the expression of biglycan, decorin, alpha -SMA & versican in CAFs. (B) Western blot illustrating the effects of treatment with cancer cell-derived conditioned medium (CM) on the expression of biglycan, decorin, alpha -SMA & versican in CAFs. TGF-beta 1 treatment (1 & 10 ng/ml) was included as a positive control. Tubulin was used as loading control (A, B). Image collected & cropped by CiteAb from the following publication (https://www.oncoscience.us/lookup/doi/10.18632/oncoscience.87), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for Biglycan Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500-1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Biglycan

Biglycan is encoded by this gene is a small cellular or pericellular matrix proteoglycan that is closely related in structure to two other small proteoglycans, decorin and fibromodulin. The encoded protein and decorin are thought to be the result of a gene duplication. Decorin contains one attached glycosaminoglycan chain, while this protein probably contains two chains. For this reason, this protein is called biglycan. This protein is thought to function in connective tissue metabolism by binding to collagen fibrils and transfering growth factor-beta. It may promote neuronal survival. This gene is a candidate gene for the Happle syndrome.

Alternate Names

BGN, DSPG1, PG-S1, SLRR1A

Gene Symbol

BGN

Additional Biglycan Products

Product Documents for Biglycan Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Biglycan Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Biglycan Antibody - BSA Free

Customer Reviews for Biglycan Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Biglycan Antibody - BSA Free and earn rewards!

Have you used Biglycan Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Biglycan Antibody - BSA Free

Showing  1 - 11 FAQ Showing All
  • Q: I have a question regarding the Biglycan antibody NBP1-84971. It is stated that the species reactivity is human; is there a chance it will work in mice to, or do you known for a fact that the antibody does not label mouse tissues? I need a anti-biglycan antibody, for IHC (paraffin) on mouse tissue; can you recommend any of your antibodies for this purpose?

    A:

    We have not yet tested this antibody on mouse, however the % homology is 95%, and our lab recommends use when the homology is 85% or above. If you would like to test this you could apply for our Innovators Reward Program. Unfortunately we do not have an anti Biglycan that has been validated for use in both mouse and IHC-P.

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies