Loading...
Key Product Details
Validated by
Orthogonal Validation, Independent Antibodies
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EKPVRTPEAKENENIHNQNPEELCTSPTLMTSQVASEPGEAKKMEDKEKDNKLISADSSEGQDQLQVSMVPENNNLTAPEPQEEVSTSENPQL
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for BIN2 Antibody - BSA Free
Immunohistochemistry-Paraffin: BIN2 Antibody [NBP2-48690]
Immunohistochemistry-Paraffin: BIN2 Antibody [NBP2-48690] - Staining of human bone marrow, liver, lymph node and pancreas using Anti-BIN2 antibody NBP2-48690 (A) shows similar protein distribution across tissues to independent antibody NBP2-48691 (B).Western Blot: BIN2 Antibody [NBP2-48690]
Western Blot: BIN2 Antibody [NBP2-48690] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: BIN2 Antibody [NBP2-48690]
Immunohistochemistry-Paraffin: BIN2 Antibody [NBP2-48690] - Staining of human liver.Immunohistochemistry-Paraffin: BIN2 Antibody [NBP2-48690]
Immunohistochemistry-Paraffin: BIN2 Antibody [NBP2-48690] - Staining of human bone marrow shows high expression.Immunohistochemistry-Paraffin: BIN2 Antibody [NBP2-48690]
Immunohistochemistry-Paraffin: BIN2 Antibody [NBP2-48690] - Staining of human pancreas shows low expression as expected.Immunohistochemistry-Paraffin: BIN2 Antibody [NBP2-48690]
Immunohistochemistry-Paraffin: BIN2 Antibody [NBP2-48690] - Staining of human lymph node.Western Blot: BIN2 Antibody - BSA Free [NBP2-48690] -
phyA and phyB mediate far-red and red lights inhibition of BL-induced degradation of BIN2 protein. (A,B) Western blotting assays showing phyA- and phyB-mediated far-red or red light inhibition of degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates in continuous darkness (DK) or far-red light (FR, 1 μmol/m2/s) (A) or red light (R, 50 μmol/m2/s) (B) for 5 days. (C,D) RT-qPCR assays showing the regulation of BIN2 expression by phyA or phyB in (A,B). Data correspond to the mean and standard deviation from three technical replicates. (E,F) Western blotting assays showing the effects of different exposure times of far-red or red light on the degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates in darkness for 5 days, and then exposed to far-red light (10 μmol/m2/s) (E) or red light (50 μmol/m2/s) (F) for the indicated lengths of time. (G,H) Western blot assays showing the effects of far-red or red light intensity on the degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates in darkness for 5 days, and then exposed to the indicated light intensities of far-red (G) or red light (H) for 6 h. (I,J) Western blot assays showing the effects of phyA or phyB on the BL-induced degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates supplemented with 2 μM BRZ in darkness for 5 days, and then treated with 1 μM BL, and then exposed to far-red (10 μmol/m2/s) (I) or red light (50 μmol/m2/s) (J) for the indicated lengths of time. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35432407), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: BIN2 Antibody - BSA Free [NBP2-48690] -
phyA and phyB interact with BIN2. (A,B) His pull-down assays showing the interactions of phyA-N, phyA-C (A), phyB-N and phyB-C (B) with BIN2. GST-BIN2 served as a bait. His-TF-phyA-N, His-TF-phyA-C, His-TF-phyB-N, His-TF-phyB-C, and His-TF served as preys. The preys were detected with alpha -His antibody. (C,D) Split-LUC assays showing the interactions of phyA (C) and phyB (D) with BIN2. The vectors expressing nLUC and/or cLUC served as negative controls. (E,F) Semi-in vivo GST pull-down assays showing far-red and red light-dependent interactions of phyA (E) and phyB (F) with BIN2, respectively. GST-BIN2 served as a bait. The protein extracts prepared from phyA-YFP-OX and Myc-phyB-OX seedlings served as preys. phyA-YFP-OX and Myc-phyB-OX seedlings were grown in dark for 5 days, and then exposed to far-red light (FR, 10 μmol/m2/s) and red light (R, 50 μmol/m2/s) for 30 min, respectively. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35432407), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: BIN2 Antibody - BSA Free [NBP2-48690] -
phyA and phyB mediate far-red and red lights inhibition of BL-induced degradation of BIN2 protein. (A,B) Western blotting assays showing phyA- and phyB-mediated far-red or red light inhibition of degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates in continuous darkness (DK) or far-red light (FR, 1 μmol/m2/s) (A) or red light (R, 50 μmol/m2/s) (B) for 5 days. (C,D) RT-qPCR assays showing the regulation of BIN2 expression by phyA or phyB in (A,B). Data correspond to the mean and standard deviation from three technical replicates. (E,F) Western blotting assays showing the effects of different exposure times of far-red or red light on the degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates in darkness for 5 days, and then exposed to far-red light (10 μmol/m2/s) (E) or red light (50 μmol/m2/s) (F) for the indicated lengths of time. (G,H) Western blot assays showing the effects of far-red or red light intensity on the degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates in darkness for 5 days, and then exposed to the indicated light intensities of far-red (G) or red light (H) for 6 h. (I,J) Western blot assays showing the effects of phyA or phyB on the BL-induced degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates supplemented with 2 μM BRZ in darkness for 5 days, and then treated with 1 μM BL, and then exposed to far-red (10 μmol/m2/s) (I) or red light (50 μmol/m2/s) (J) for the indicated lengths of time. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35432407), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: BIN2 Antibody - BSA Free [NBP2-48690] -
phyA and phyB mediate far-red and red lights inhibition of BL-induced degradation of BIN2 protein. (A,B) Western blotting assays showing phyA- and phyB-mediated far-red or red light inhibition of degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates in continuous darkness (DK) or far-red light (FR, 1 μmol/m2/s) (A) or red light (R, 50 μmol/m2/s) (B) for 5 days. (C,D) RT-qPCR assays showing the regulation of BIN2 expression by phyA or phyB in (A,B). Data correspond to the mean and standard deviation from three technical replicates. (E,F) Western blotting assays showing the effects of different exposure times of far-red or red light on the degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates in darkness for 5 days, and then exposed to far-red light (10 μmol/m2/s) (E) or red light (50 μmol/m2/s) (F) for the indicated lengths of time. (G,H) Western blot assays showing the effects of far-red or red light intensity on the degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates in darkness for 5 days, and then exposed to the indicated light intensities of far-red (G) or red light (H) for 6 h. (I,J) Western blot assays showing the effects of phyA or phyB on the BL-induced degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates supplemented with 2 μM BRZ in darkness for 5 days, and then treated with 1 μM BL, and then exposed to far-red (10 μmol/m2/s) (I) or red light (50 μmol/m2/s) (J) for the indicated lengths of time. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35432407), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: BIN2 Antibody - BSA Free [NBP2-48690] -
phyA and phyB mediate far-red and red lights inhibition of BL-induced degradation of BIN2 protein. (A,B) Western blotting assays showing phyA- and phyB-mediated far-red or red light inhibition of degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates in continuous darkness (DK) or far-red light (FR, 1 μmol/m2/s) (A) or red light (R, 50 μmol/m2/s) (B) for 5 days. (C,D) RT-qPCR assays showing the regulation of BIN2 expression by phyA or phyB in (A,B). Data correspond to the mean and standard deviation from three technical replicates. (E,F) Western blotting assays showing the effects of different exposure times of far-red or red light on the degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates in darkness for 5 days, and then exposed to far-red light (10 μmol/m2/s) (E) or red light (50 μmol/m2/s) (F) for the indicated lengths of time. (G,H) Western blot assays showing the effects of far-red or red light intensity on the degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates in darkness for 5 days, and then exposed to the indicated light intensities of far-red (G) or red light (H) for 6 h. (I,J) Western blot assays showing the effects of phyA or phyB on the BL-induced degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates supplemented with 2 μM BRZ in darkness for 5 days, and then treated with 1 μM BL, and then exposed to far-red (10 μmol/m2/s) (I) or red light (50 μmol/m2/s) (J) for the indicated lengths of time. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35432407), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: BIN2 Antibody - BSA Free [NBP2-48690] -
phyA and phyB mediate far-red and red lights inhibition of BL-induced degradation of BIN2 protein. (A,B) Western blotting assays showing phyA- and phyB-mediated far-red or red light inhibition of degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates in continuous darkness (DK) or far-red light (FR, 1 μmol/m2/s) (A) or red light (R, 50 μmol/m2/s) (B) for 5 days. (C,D) RT-qPCR assays showing the regulation of BIN2 expression by phyA or phyB in (A,B). Data correspond to the mean and standard deviation from three technical replicates. (E,F) Western blotting assays showing the effects of different exposure times of far-red or red light on the degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates in darkness for 5 days, and then exposed to far-red light (10 μmol/m2/s) (E) or red light (50 μmol/m2/s) (F) for the indicated lengths of time. (G,H) Western blot assays showing the effects of far-red or red light intensity on the degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates in darkness for 5 days, and then exposed to the indicated light intensities of far-red (G) or red light (H) for 6 h. (I,J) Western blot assays showing the effects of phyA or phyB on the BL-induced degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates supplemented with 2 μM BRZ in darkness for 5 days, and then treated with 1 μM BL, and then exposed to far-red (10 μmol/m2/s) (I) or red light (50 μmol/m2/s) (J) for the indicated lengths of time. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35432407), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: BIN2 Antibody - BSA Free [NBP2-48690] -
phyA and phyB mediate far-red and red lights inhibition of BL-induced degradation of BIN2 protein. (A,B) Western blotting assays showing phyA- and phyB-mediated far-red or red light inhibition of degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates in continuous darkness (DK) or far-red light (FR, 1 μmol/m2/s) (A) or red light (R, 50 μmol/m2/s) (B) for 5 days. (C,D) RT-qPCR assays showing the regulation of BIN2 expression by phyA or phyB in (A,B). Data correspond to the mean and standard deviation from three technical replicates. (E,F) Western blotting assays showing the effects of different exposure times of far-red or red light on the degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates in darkness for 5 days, and then exposed to far-red light (10 μmol/m2/s) (E) or red light (50 μmol/m2/s) (F) for the indicated lengths of time. (G,H) Western blot assays showing the effects of far-red or red light intensity on the degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates in darkness for 5 days, and then exposed to the indicated light intensities of far-red (G) or red light (H) for 6 h. (I,J) Western blot assays showing the effects of phyA or phyB on the BL-induced degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates supplemented with 2 μM BRZ in darkness for 5 days, and then treated with 1 μM BL, and then exposed to far-red (10 μmol/m2/s) (I) or red light (50 μmol/m2/s) (J) for the indicated lengths of time. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35432407), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: BIN2 Antibody - BSA Free [NBP2-48690] -
phyA and phyB mediate far-red and red lights inhibition of BL-induced degradation of BIN2 protein. (A,B) Western blotting assays showing phyA- and phyB-mediated far-red or red light inhibition of degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates in continuous darkness (DK) or far-red light (FR, 1 μmol/m2/s) (A) or red light (R, 50 μmol/m2/s) (B) for 5 days. (C,D) RT-qPCR assays showing the regulation of BIN2 expression by phyA or phyB in (A,B). Data correspond to the mean and standard deviation from three technical replicates. (E,F) Western blotting assays showing the effects of different exposure times of far-red or red light on the degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates in darkness for 5 days, and then exposed to far-red light (10 μmol/m2/s) (E) or red light (50 μmol/m2/s) (F) for the indicated lengths of time. (G,H) Western blot assays showing the effects of far-red or red light intensity on the degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates in darkness for 5 days, and then exposed to the indicated light intensities of far-red (G) or red light (H) for 6 h. (I,J) Western blot assays showing the effects of phyA or phyB on the BL-induced degradation of BIN2 protein. WT, phyA and phyB mutant seedlings were grown on MS plates supplemented with 2 μM BRZ in darkness for 5 days, and then treated with 1 μM BL, and then exposed to far-red (10 μmol/m2/s) (I) or red light (50 μmol/m2/s) (J) for the indicated lengths of time. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35432407), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for BIN2 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200 - 1:500
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: BIN2
Alternate Names
BRAP1, BRAP-1, breast cancer associated protein BRAP1, Breast cancer-associated protein 1, bridging integrator 2, bridging integrator-2
Gene Symbol
BIN2
Additional BIN2 Products
Product Documents for BIN2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for BIN2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for BIN2 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review BIN2 Antibody - BSA Free and earn rewards!
Have you used BIN2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...