BPIL1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-14358

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: KLCLSISNLVQGVNVHLGTLIGLNPVGPESQIRYSMVSVPTVTSDYISLEVNAVLFLLGKPIILPTDAT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for BPIL1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: BPIL1 Antibody [NBP2-14358]

Immunocytochemistry/ Immunofluorescence: BPIL1 Antibody [NBP2-14358]

Immunocytochemistry/Immunofluorescence: BPIL1 Antibody [NBP2-14358] - Immunofluorescent staining of human cell line Hep G2 shows localization to vesicles.
Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-14358]

Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-14358]

Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-14358] - Staining of human kidney.
Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-14358]

Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-14358]

Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-14358] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-14358]

Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-14358]

Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-14358] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-14358]

Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-14358]

Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-14358] - Staining of human salivary gland shows high expression.
Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-14358]

Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-14358]

Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-14358] - Staining in human salivary gland and liver tissues using anti-BPIFB2 antibody. Corresponding BPIFB2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-14358]

Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-14358]

Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-14358] - Staining of human colon, kidney, liver and salivary gland using Anti-BPIFB2 antibody NBP2-14358 (A) shows similar protein distribution across tissues to independent antibody NBP2-38887 (B).
Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-14358]

Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-14358]

Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-14358] - Staining of human colon.

Applications for BPIL1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BPIL1

The BPIL1 gene encodes a member of the lipid transfer/lipopolysaccharide binding protein (LT/LBP) gene family. It is highly expressed in hypertrophic tonsils. This gene and three other members of the LT/LBP gene family form a cluster on the long arm of chromos

Alternate Names

bactericidal/permeability-increasing protein-like 1, C20orf184, Long palate, lung and nasal epithelium carcinoma-associated protein 2, LPLUNC2dJ726C3.2, RYSR

Gene Symbol

BPIFB2

Additional BPIL1 Products

Product Documents for BPIL1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for BPIL1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for BPIL1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BPIL1 Antibody - BSA Free and earn rewards!

Have you used BPIL1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...