Cadherin-17 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88238

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: HPIKITQVRWNDPGAQYSLVDKEKLPRFPFSIDQEGDIYVTQPLDREEKDAYVFYAVAKDEYGKPLSYPLEIHVKVK

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (82%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Cadherin-17 Antibody - BSA Free

Cadherin-17 Antibody - BSA Free Western Blot: Cadherin-17 Antibody - BSA Free [NBP1-88238]

Western Blot: Cadherin-17 Antibody - BSA Free [NBP1-88238]

Analysis in human cell lines Caco-2 and A-431 using Anti-CDH17 antibody. Corresponding CDH17 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
Immunohistochemistry-Paraffin: Cadherin-17 Antibody [NBP1-88238]

Immunohistochemistry-Paraffin: Cadherin-17 Antibody [NBP1-88238]

Immunohistochemistry-Paraffin: Cadherin-17 Antibody [NBP1-88238] - Analysis in human duodenum and liver tissues using NBP1-88238 antibody. Corresponding Cadherin-17 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Cadherin-17 Antibody [NBP1-88238]

Immunohistochemistry-Paraffin: Cadherin-17 Antibody [NBP1-88238]

Immunohistochemistry-Paraffin: Cadherin-17 Antibody [NBP1-88238] - Staining of human duodenum shows strong membranous positivity in glandular cells.
Cadherin-17 Antibody - BSA Free Immunohistochemistry-Paraffin: Cadherin-17 Antibody - BSA Free [NBP1-88238]

Immunohistochemistry-Paraffin: Cadherin-17 Antibody - BSA Free [NBP1-88238]

Staining of human liver shows no positivity in hepatocytes as expected.
Cadherin-17 Antibody

Immunohistochemistry-Paraffin: Cadherin-17 Antibody [NBP1-88238] -

Immunohistochemistry-Paraffin: Cadherin-17 Antibody [NBP1-88238] - Staining of human kidney shows no positivity in cells in tubules as expected.
Cadherin-17 Antibody Immunohistochemistry-Paraffin: Cadherin-17 Antibody Antibody [NBP1-88238]

Immunohistochemistry-Paraffin: Cadherin-17 Antibody Antibody [NBP1-88238]

Staining of human colon, duodenum, kidney and liver using NBP1-88238 (A) shows similar protein distribution across tissues to independent antibody NBP1-88239 (B).
Cadherin-17 Antibody - BSA Free Immunohistochemistry-Paraffin: Cadherin-17 Antibody - BSA Free [NBP1-88238]

Immunohistochemistry-Paraffin: Cadherin-17 Antibody - BSA Free [NBP1-88238]

Staining of human colon shows strong membranous positivity in glandular cells.

Applications for Cadherin-17 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Cadherin-17

LI Cadherin is a member of the cadherin superfamily, genes encoding calcium-dependent, membrane-associated glycoproteins. The encoded protein is cadherin-like, consisting of an extracellular region, containing 7 cadherin domains, and a transmembrane region but lacking the conserved cytoplasmic domain. The protein is a component of the gastrointestinal tract and pancreatic ducts, acting as an intestinal proton-dependent peptide transporter in the first step in oral absorption of many medically important peptide-based drugs. The protein may also play a role in the morphological organization of liver and intestine.

Alternate Names

Cadherin17, CDH17

Gene Symbol

CDH17

Additional Cadherin-17 Products

Product Documents for Cadherin-17 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Cadherin-17 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Citations for Cadherin-17 Antibody - BSA Free

Customer Reviews for Cadherin-17 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Cadherin-17 Antibody - BSA Free and earn rewards!

Have you used Cadherin-17 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...