CADPS Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-04378

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all CADPS Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1020-1100 of human CADPS (NP_899630.1). MASDMIESCVKRTRIAFEVKLQKTSRSTDFRVPQSICTMFNVMVDAKAQSTKLCSMEMGQEHQYHSKIDELIEETVKEMIT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

153 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CADPS Antibody - Azide and BSA Free

Immunohistochemistry-Paraffin: CADPS Antibody - Azide and BSA Free [NBP3-04378]

Immunohistochemistry-Paraffin: CADPS Antibody - Azide and BSA Free [NBP3-04378]

Immunohistochemistry-Paraffin: CADPS Antibody [NBP3-04378] - Paraffin-embedded human breast cancer using CADPS antibody at dilution of 1:100 (40x lens).
Immunohistochemistry-Paraffin: CADPS Antibody - Azide and BSA Free [NBP3-04378]

Immunohistochemistry-Paraffin: CADPS Antibody - Azide and BSA Free [NBP3-04378]

Immunohistochemistry-Paraffin: CADPS Antibody [NBP3-04378] - Paraffin-embedded human stomach using CADPS antibody at dilution of 1:100 (40x lens).

Applications for CADPS Antibody - Azide and BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50-1:200

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CADPS

CADPS encodes a novel neural/endocrine-specific cytosolic and peripheral membrane protein required for the Ca2+-regulated exocytosis of secretory vesicles. The protein acts at a stage in exocytosis that follows ATP-dependent priming, which involves the essential synthesis of phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2). Alternative splicing has been observed at this locus and three variants, encoding distinct isoforms, are described. [provided by RefSeq]

Alternate Names

Ca++-dependent secretion activator, CADPS1, Calcium-dependent activator protein for secretion 1, calcium-dependent secretion activator 1, CAPS-1, CAPS1Ca2+-dependent secretion activator, CAPSCa2+-dependent activator protein for secretion, KIAA1121Ca2+-regulated cytoskeletal protein

Gene Symbol

CADPS

Additional CADPS Products

Product Documents for CADPS Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CADPS Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for CADPS Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review CADPS Antibody - Azide and BSA Free and earn rewards!

Have you used CADPS Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies