Calbindin D-28K Antibody (1K2K2)

Novus Biologicals | Catalog # NBP3-16209

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 1K2K2 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Calbindin D-28K (P05937). MAESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKTFVDQYGQRDDGKIGIVELAHVLPTEENFLLLFRCQQLKSC

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Calbindin D-28K Antibody (1K2K2)

Calbindin D-28K Antibody (1K2K2)

Immunocytochemistry/ Immunofluorescence: Calbindin D-28K Antibody (1K2K2) [NBP3-16209] -

Immunocytochemistry/ Immunofluorescence: Calbindin D-28K Antibody (1K2K2) [NBP3-16209] - Confocal imaging of paraffin-embedded Mouse brain tissue using Calbindin D-28K Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
Calbindin D-28K Antibody (1K2K2)

Calbindin D-28K Antibody (1K2K2) [NBP3-16209] -

Analysis of lysates from Rat brain using Calbindin Rabbit mAb at 1:1000 dilution incubated overnight at 4℃.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 30 s.
Calbindin D-28K Antibody (1K2K2)

Calbindin D-28K Antibody (1K2K2) [NBP3-16209] -

Analysis of lysates from Rat brain using Calbindin Rabbit mAb at 1:1000 dilution incubated overnight at 4℃.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 30 s.
Calbindin D-28K Antibody (1K2K2)

Calbindin D-28K Antibody (1K2K2) [NBP3-16209] -

Human kidney tissue using Calbindin Rabbit mAb (dilution 1:100) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.

Applications for Calbindin D-28K Antibody (1K2K2)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Calbindin D-28K

Calbindin D28k is a member of a large family of intracellular calcium-binding proteins, containing EF-hand calcium binding motifs, and related to calmodulin and troponin-C. The biological roles of Calbindin D28k include calcium regulation and calcium-dependent signalling in neurons and during development. Decreases in Calbindin D28k abundance, or loss of Calbindin D28k immunoreactivity, is found in models of neurological disorders such as epilepsy, and in neurodegenerative diseases. Calbindin antibody is often used as a marker for cerebellum Purkinje cells.

Alternate Names

CAB27, CALB, calbindin, calbindin 1, (28kD), calbindin 1, 28kDa, Calbindin D28, D-28K, RTVL-H protein, Vitamin D-dependent calcium-binding protein, avian-type

Gene Symbol

CALB1

Additional Calbindin D-28K Products

Product Documents for Calbindin D-28K Antibody (1K2K2)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Calbindin D-28K Antibody (1K2K2)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Calbindin D-28K Antibody (1K2K2)

There are currently no reviews for this product. Be the first to review Calbindin D-28K Antibody (1K2K2) and earn rewards!

Have you used Calbindin D-28K Antibody (1K2K2)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Calbindin D-28K Antibody (1K2K2)

Showing  1 - 11 FAQ Showing All
  • Q: I am doing research on Neuroscience and I would like to use some antibodies, especially in Western Blots, but I could do other assays: - alpha7 nicotinic cholinergic receptor; - parvalbumin; - calbindin D28K; The preferred reactivity is anti-human and anti-mouse. Do you have these antibodies? Are they in stock? And what about the prizes: How much are they? How much are the shipping costs? Could you make me any offer?

    A:

    This link will take you to all of our alpha7 nicotinic cholingergic receptor antibodies currently available for purchase. Please see the following link for our Calbinin D28K antibodies reactive against mouse and human. We currently do not have any Parvalbumin antibodies that have been tested in mouse. I would like to introduce you to our Innovators Reward Program. Try our primary antibodies in an untested species or application, without the financial risk of failure. The pricing and availability of our products depends on your country.

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies
Loading...