Calbindin D-28K Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-86664

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (98%), Rat (99%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: QSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKTFVDQYGQRDDGKIGIVELAHVLPTEENFLLLFRCQQ

Marker

Neuronal Marker

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Calbindin D-28K Antibody - BSA Free

Calbindin D-28K Antibody - BSA Free Western Blot: Calbindin D-28K Antibody - BSA Free [NBP1-86664]

Western Blot: Calbindin D-28K Antibody - BSA Free [NBP1-86664]

Analysis in human kidney tissue.
Calbindin D-28K Antibody - BSA Free Immunohistochemistry-Paraffin: Calbindin D-28K Antibody - BSA Free [NBP1-86664]

Immunohistochemistry-Paraffin: Calbindin D-28K Antibody - BSA Free [NBP1-86664]

Analysis in human kidney and skeletal muscle tissues Corresponding CALB1 RNA-seq data are presented for the same tissues.
Calbindin D-28K Antibody - BSA Free Immunohistochemistry-Paraffin: Calbindin D-28K Antibody - BSA Free [NBP1-86664]

Immunohistochemistry-Paraffin: Calbindin D-28K Antibody - BSA Free [NBP1-86664]

Staining of human kidney shows strong nuclear and cytoplasmic positivity in cells in tubules.
Calbindin D-28K Antibody - BSA Free Immunohistochemistry-Paraffin: Calbindin D-28K Antibody - BSA Free [NBP1-86664]

Immunohistochemistry-Paraffin: Calbindin D-28K Antibody - BSA Free [NBP1-86664]

Staining of human skeletal muscle shows no positivity in myocytes as expected.
Calbindin D-28K Antibody - BSA Free Immunohistochemistry-Paraffin: Calbindin D-28K Antibody - BSA Free [NBP1-86664]

Immunohistochemistry-Paraffin: Calbindin D-28K Antibody - BSA Free [NBP1-86664]

Staining of human cerebellum, kidney, pancreas and skeletal muscle using Anti-CALB1 antibody NBP1-86664 (A) shows similar protein distribution across tissues to independent antibody NBP2-38798 (B).
Calbindin D-28K Antibody - BSA Free Immunohistochemistry-Paraffin: Calbindin D-28K Antibody - BSA Free [NBP1-86664]

Immunohistochemistry-Paraffin: Calbindin D-28K Antibody - BSA Free [NBP1-86664]

Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Calbindin D-28K Antibody - BSA Free Immunohistochemistry-Paraffin: Calbindin D-28K Antibody - BSA Free [NBP1-86664]

Immunohistochemistry-Paraffin: Calbindin D-28K Antibody - BSA Free [NBP1-86664]

Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Calbindin D-28K Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: Calbindin D-28K Antibody [NBP1-86664]

Immunocytochemistry/ Immunofluorescence: Calbindin D-28K Antibody [NBP1-86664]

Staining of human cell line U-251 MG shows localization to vesicles.

Applications for Calbindin D-28K Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:5000 - 1:10000

Immunohistochemistry-Paraffin

1:5000 - 1:10000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Calbindin D-28K

Calbindin D28k is a member of a large family of intracellular calcium-binding proteins, containing EF-hand calcium binding motifs, and related to calmodulin and troponin-C. The biological roles of Calbindin D28k include calcium regulation and calcium-dependent signalling in neurons and during development. Decreases in Calbindin D28k abundance, or loss of Calbindin D28k immunoreactivity, is found in models of neurological disorders such as epilepsy, and in neurodegenerative diseases. Calbindin antibody is often used as a marker for cerebellum Purkinje cells.

Alternate Names

CAB27, CALB, calbindin, calbindin 1, (28kD), calbindin 1, 28kDa, Calbindin D28, D-28K, RTVL-H protein, Vitamin D-dependent calcium-binding protein, avian-type

Gene Symbol

CALB1

Additional Calbindin D-28K Products

Product Documents for Calbindin D-28K Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Calbindin D-28K Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Calbindin D-28K Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Calbindin D-28K Antibody - BSA Free and earn rewards!

Have you used Calbindin D-28K Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Calbindin D-28K Antibody - BSA Free

Showing  1 - 11 FAQ Showing All
  • Q: I am doing research on Neuroscience and I would like to use some antibodies, especially in Western Blots, but I could do other assays: - alpha7 nicotinic cholinergic receptor; - parvalbumin; - calbindin D28K; The preferred reactivity is anti-human and anti-mouse. Do you have these antibodies? Are they in stock? And what about the prizes: How much are they? How much are the shipping costs? Could you make me any offer?

    A:

    This link will take you to all of our alpha7 nicotinic cholingergic receptor antibodies currently available for purchase. Please see the following link for our Calbinin D28K antibodies reactive against mouse and human. We currently do not have any Parvalbumin antibodies that have been tested in mouse. I would like to introduce you to our Innovators Reward Program. Try our primary antibodies in an untested species or application, without the financial risk of failure. The pricing and availability of our products depends on your country.

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies
Loading...