Calnexin Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85520

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: DVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTYKAPVPTGEVYFADSFDRGTLSGWILSKAKKDDTDDEI

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (89%). Reactivity reported in scientific literature (PMID: 22361696)

Marker

Endoplasmic Reticulum Membrane Marker

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Calnexin Antibody - BSA Free

Immunohistochemistry-Paraffin: Calnexin Antibody [NBP1-85520]

Immunohistochemistry-Paraffin: Calnexin Antibody [NBP1-85520]

Immunohistochemistry-Paraffin: Calnexin Antibody [NBP1-85520] - Staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: Calnexin Antibody [NBP1-85520]

Immunohistochemistry-Paraffin: Calnexin Antibody [NBP1-85520]

Immunohistochemistry-Paraffin: Calnexin Antibody [NBP1-85520] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: Calnexin Antibody [NBP1-85520]

Immunohistochemistry-Paraffin: Calnexin Antibody [NBP1-85520]

Immunohistochemistry-Paraffin: Calnexin Antibody [NBP1-85520] - Staining of human cerebral cortex, placenta, testis and tonsil using Anti-Calnexin antibody NBP1-85520 (A) shows similar protein distribution across tissues to independent antibody NBP1-85519 (B).
Immunohistochemistry-Paraffin: Calnexin Antibody [NBP1-85520]

Immunohistochemistry-Paraffin: Calnexin Antibody [NBP1-85520]

Immunohistochemistry-Paraffin: Calnexin Antibody [NBP1-85520] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: Calnexin Antibody [NBP1-85520]

Immunohistochemistry-Paraffin: Calnexin Antibody [NBP1-85520]

Immunohistochemistry-Paraffin: Calnexin Antibody [NBP1-85520] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Applications for Calnexin Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Calnexin

Calnexin, an abundant approx. 90kDa integral protein of the endoplasmic reticulum, is also referred to as IP90, p88 and p90 (1). It consists of a large 50kDa N-terminal calcium-binding luminal domain, a single transmembrane helix and a short acidic cytoplasmic tail (2, 3). Unlike its ER counterparts which have a KDEL sequence on their Cterminus to ensure ER retention (4), calnexin has positively charged cytosolic residues that do the same thing (3). Most ER proteins act as molecular chaperones and participate in the proper folding of polypeptides and their assembly into mulit-subunit proteins. Calnexin together with calreticulin, plays a key role in glycoprotein folding and its control within the ER, by interacting with folding intermediates via their monoglycosylated glycans (5, 6). Calnexin has also been shown to associate with the major histocompatability complex class I heavy chains, partial complexes of the T cell receptor and B cell membrane immunoglobulin (7).

Alternate Names

calnexin, CNX, IP90FLJ26570, Major histocompatibility complex class I antigen-binding protein p88, P90

Gene Symbol

CANX

Additional Calnexin Products

Product Documents for Calnexin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Calnexin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Calnexin Antibody - BSA Free

Customer Reviews for Calnexin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Calnexin Antibody - BSA Free and earn rewards!

Have you used Calnexin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...