CASC4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-30492

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: NTYLVKRLEYESFQCGQQMKELRAQHEENIKKLADQFLEEQKQETQKIQSNDGKELDINNQVVPKNIPKVAENVADKNE

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (82%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CASC4 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: CASC4 Antibody [NBP2-30492]

Immunocytochemistry/ Immunofluorescence: CASC4 Antibody [NBP2-30492]

Immunocytochemistry/Immunofluorescence: CASC4 Antibody [NBP2-30492] - Immunofluorescent staining of human cell line U-2 OS shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: CASC4 Antibody [NBP2-30492]

Immunohistochemistry-Paraffin: CASC4 Antibody [NBP2-30492]

Immunohistochemistry-Paraffin: CASC4 Antibody [NBP2-30492] - Staining of human liver.
Immunohistochemistry: CASC4 Antibody [NBP2-30492]

Immunohistochemistry: CASC4 Antibody [NBP2-30492]

Immunohistochemistry: CASC4 Antibody [NBP2-30492] - Staining of human cerebral cortex shows strong cytoplasmic positivity with a granular pattern in neuronal cells.
Immunohistochemistry-Paraffin: CASC4 Antibody [NBP2-30492]

Immunohistochemistry-Paraffin: CASC4 Antibody [NBP2-30492]

Immunohistochemistry-Paraffin: CASC4 Antibody [NBP2-30492] - Staining of human cerebral cortex, liver, lymph node and pancreas using Anti-CASC4 antibody NBP2-30492 (A) shows similar protein distribution across tissues to independent antibody NBP2-30507 (B).
Immunohistochemistry-Paraffin: CASC4 Antibody [NBP2-30492]

Immunohistochemistry-Paraffin: CASC4 Antibody [NBP2-30492]

Immunohistochemistry-Paraffin: CASC4 Antibody [NBP2-30492] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: CASC4 Antibody [NBP2-30492]

Immunohistochemistry-Paraffin: CASC4 Antibody [NBP2-30492]

Immunohistochemistry-Paraffin: CASC4 Antibody [NBP2-30492] - Staining of human lymph node.
Immunohistochemistry-Paraffin: CASC4 Antibody [NBP2-30492]

Immunohistochemistry-Paraffin: CASC4 Antibody [NBP2-30492]

Immunohistochemistry-Paraffin: CASC4 Antibody [NBP2-30492] - Staining of human pancreas.

Applications for CASC4 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CASC4

The increased expression level of this gene is associated with HER-2/neu proto-oncogene overexpression. Amplification and resulting overexpression of this proto-oncogene are found in approximately 30% of human breast and 20% of human ovarian cancers. Further characterization of the product of this gene may yield insight into the fundamental biology and pathogenetic effects of HER-2/neu overexpression in human breast and ovarian cancer cells. Alternatively spliced variants encoding different isoforms have been identified for this gene. [provided by RefSeq]

Alternate Names

cancer susceptibility candidate 4, Cancer susceptibility candidate gene 4 protein, DKFZp459F1927, gene associated with HER-2/neu overexpression, H63, MGC74708, protein CASC4

Gene Symbol

CASC4

UniProt

Additional CASC4 Products

Product Documents for CASC4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CASC4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CASC4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CASC4 Antibody - BSA Free and earn rewards!

Have you used CASC4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...