CFAP74 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-90921
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LDVPVESLTAIPVFDPRHREASSRPGPLSPEAEELRPILVTLDYIQFDTDTPAPPATRELQVGCIRTTQPSPKK
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for CFAP74 Antibody - BSA Free
![Immunohistochemistry-Paraffin: CFAP74 Antibody [NBP1-90921]](https://resources.rndsystems.com/images/products/C1orf222-Antibody-Immunohistochemistry-Paraffin-NBP1-90921-img0006.jpg "Immunohistochemistry-Paraffin: CFAP74 Antibody [NBP1-90921]")
Immunohistochemistry-Paraffin: CFAP74 Antibody [NBP1-90921]
Immunohistochemistry-Paraffin: C1orf222 Antibody [NBP1-90921] - Staining of human fallopian tube shows high expression.
Immunohistochemistry-Paraffin: C1orf222 Antibody [NBP1-90921] -
Immunohistochemistry-Paraffin: C1orf222 Antibody [NBP1-90921] - Staining of human tonsil shows negative membranous positivity in non-germinal center cells and germinal center cells as expected.
Immunohistochemistry-Paraffin: C1orf222 Antibody [NBP1-90921] -
Immunohistochemistry-Paraffin: C1orf222 Antibody [NBP1-90921] - Staining of human pancreas shows negative membranous positivity in exocrine glandular cells and endocrine glandular cells as expected.![CFAP74 Antibody - BSA Free Immunohistochemistry: CFAP74 Antibody - BSA Free [NBP1-90921]](https://resources.rndsystems.com/images/products/nbp1-90921_rabbit-polyclonal-cfap74-antibody-30520259585124.jpg "Immunohistochemistry: CFAP74 Antibody - BSA Free [NBP1-90921]")
Immunohistochemistry: CFAP74 Antibody - BSA Free [NBP1-90921]
Staining of human tonsil shows negative membranous positivity in non-germinal center cells and germinal center cells as expected.![CFAP74 Antibody - BSA Free Immunohistochemistry: CFAP74 Antibody - BSA Free [NBP1-90921]](https://resources.rndsystems.com/images/products/nbp1-90921_rabbit-polyclonal-cfap74-antibody-295202516344619.jpg "Immunohistochemistry: CFAP74 Antibody - BSA Free [NBP1-90921]")
Immunohistochemistry: CFAP74 Antibody - BSA Free [NBP1-90921]
Staining of human kidney shows negative membranous positivity in cells in tubules and cells in glomeruli as expected.![CFAP74 Antibody - BSA Free Immunohistochemistry: CFAP74 Antibody - BSA Free [NBP1-90921]](https://resources.rndsystems.com/images/products/nbp1-90921_rabbit-polyclonal-cfap74-antibody-29520251672810.jpg "Immunohistochemistry: CFAP74 Antibody - BSA Free [NBP1-90921]")
![CFAP74 Antibody - BSA Free Immunohistochemistry: CFAP74 Antibody - BSA Free [NBP1-90921]](https://resources.rndsystems.com/images/products/nbp1-90921_rabbit-polyclonal-cfap74-antibody-295202516464814.jpg "Immunohistochemistry: CFAP74 Antibody - BSA Free [NBP1-90921]")
Immunohistochemistry: CFAP74 Antibody - BSA Free [NBP1-90921]
Staining of human pancreas shows negative membranous positivity in exocrine glandular cells and endocrine glandular cells as expected.Applications for CFAP74 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:500 - 1:1000
Immunohistochemistry-Paraffin
1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: CFAP74
Alternate Names
chromosome 1 open reading frame 222, Cilia And Flagella Associated Protein 74, Cilia- And Flagella-Associated Protein 74, KIAA1751, MGC133181
Gene Symbol
CFAP74
Additional CFAP74 Products
Product Documents for CFAP74 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for CFAP74 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for CFAP74 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review CFAP74 Antibody - BSA Free and earn rewards!
Have you used CFAP74 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...