CGGBP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-32680

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (96%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: PLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSIPKSDQLRRAYLPDGYENENQLLNSQD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CGGBP1 Antibody - BSA Free

Western Blot: CGGBP1 Antibody [NBP2-32680]

Western Blot: CGGBP1 Antibody [NBP2-32680]

Western Blot: CGGBP1 Antibody [NBP2-32680] - Analysis using Anti-CGGBP1 antibody NBP2-32680 (A) shows similar pattern to independent antibody NBP1-84528 (B).
Immunocytochemistry/ Immunofluorescence: CGGBP1 Antibody [NBP2-32680]

Immunocytochemistry/ Immunofluorescence: CGGBP1 Antibody [NBP2-32680]

Immunocytochemistry/Immunofluorescence: CGGBP1 Antibody [NBP2-32680] - Immunofluorescent staining of human cell line RH-30 shows localization to nucleus.
CGGBP1 Antibody - BSA Free Chromatin Immunoprecipitation ChIP: CGGBP1 Antibody - BSA Free

Chromatin Immunoprecipitation ChIP: CGGBP1 Antibody - BSA Free

ChIP-Exo-Seq composite graph for Anti-CGGBP1 tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.
CGGBP1 Antibody - BSA Free Immunohistochemistry-Paraffin: CGGBP1 Antibody [NBP2-32680]

Immunohistochemistry-Paraffin: CGGBP1 Antibody [NBP2-32680]

Staining of human small intestine shows strong nuclear positivity in glandular cells.
CGGBP1 Antibody - BSA Free Immunohistochemistry-Paraffin: CGGBP1 Antibody [NBP2-32680]

Immunohistochemistry-Paraffin: CGGBP1 Antibody [NBP2-32680]

Staining of human tonsil shows strong nuclear positivity in non-germinal center cells.
CGGBP1 Antibody - BSA Free Immunohistochemistry-Paraffin: CGGBP1 Antibody [NBP2-32680]

Immunohistochemistry-Paraffin: CGGBP1 Antibody [NBP2-32680]

Staining of human kidney shows strong nuclear positivity in cells in tubules.
CGGBP1 Antibody - BSA Free Immunohistochemistry-Paraffin: CGGBP1 Antibody [NBP2-32680]

Immunohistochemistry-Paraffin: CGGBP1 Antibody [NBP2-32680]

Staining of human placenta shows strong nuclear positivity in trophoblastic cells.

Applications for CGGBP1 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CGGBP1

CGGBP1 influences expression of the FMR1 gene (MIM 309550), which is associated with the fragile X mental retardation syndrome (MIM 300624), by specifically interacting with the 5-prime (CGG)n-3-prime repeat in its 5-prime UTR.[supplied by OMIM]

Alternate Names

20 kDa CGG-binding protein, CGG triplet repeat binding protein 1, CGG triplet repeat-binding protein 1, CGG-binding protein 1, CGGBPp20-CGGBP, p20-CGG binding protein, p20-CGGBP DNA-binding protein

Gene Symbol

CGGBP1

Additional CGGBP1 Products

Product Documents for CGGBP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CGGBP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CGGBP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CGGBP1 Antibody - BSA Free and earn rewards!

Have you used CGGBP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...