CHRFAM7A Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38474

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human CHRFAM7A (NP_647536.1).

Sequence:
MQKYCIYQHFQFQLLIQHLWIAANCDIADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

46 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CHRFAM7A Antibody - BSA Free

CHRFAM7A Antibody

Immunohistochemistry: CHRFAM7A Antibody [NBP3-38474] -

Immunohistochemistry: CHRFAM7A Antibody [NBP3-38474] - Immunohistochemistry analysis of paraffin-embedded Human prostate using CHRFAM7A Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
CHRFAM7A Antibody

Western Blot: CHRFAM7A Antibody [NBP3-38474] -

Western Blot: CHRFAM7A Antibody [NBP3-38474] - Western blot analysis of various lysates using CHRFAM7A Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates / proteins: 25 ug per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 15s.
CHRFAM7A Antibody

Western Blot: CHRFAM7A Antibody [NBP3-38474] -

Western Blot: CHRFAM7A Antibody [NBP3-38474] - Western Blot analysis of various lysates using CHRFAM7A Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates / proteins: 25 ug per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 15s.

Applications for CHRFAM7A Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CHRFAM7A

CHRFAM7A is a gene that codes for a multi-pass membrane protein expressed in the hippocampus that is 412 amino acids long and weighs approximately 46 kDa. Current studies are being done on diseases and disorders related to this gene including neuronitis, Alzheimer's disease, juvenile myoclonic epilepsy, bipolar affective disorder, schizoaffective disorder, pharyngitis, and dementia. CHRFAM7A has been shown to have involvement in pathways such as the SIDS susceptibility pathway.

Alternate Names

CHRNA7, CHRNA7 (cholinergic receptor, nicotinic, alpha 7, exons 5-10) and FAM7A (familywith sequence similarity 7A, exons A-E) fusion, CHRNA7 (cholinergic receptor, nicotinic, alpha polypeptide 7, exons 5-10) andFAM7A (family with sequence similarity 7A, exons A-E) fusion, CHRNA7-DR1alpha 7 neuronal nicotinic acetylcholine receptor-FAM7A hybrid, CHRNA7-FAM7A fusion protein, D-10alpha-7 nicotinic cholinergic receptor subunit, MGC120482, MGC120483

Gene Symbol

CHRFAM7A

Additional CHRFAM7A Products

Product Documents for CHRFAM7A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CHRFAM7A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CHRFAM7A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CHRFAM7A Antibody - BSA Free and earn rewards!

Have you used CHRFAM7A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...